Video Converters
Vidsify for Mac
1.2Vidsify for Mac is a powerful video software that allows you to convert almost any video file into formats supported by your Apple devices and game consoles. Whether you have recorded videos on point-and-shoot cameras or cell phones, or downloaded them online, Vidsify makes it easy to convert them into the format of your choice. With Vidsify, you don't need any knowledge of video or audio codecs. Simply choose the devices your video must support and Vidsify will automatically determine the rest. This means that even if you're not tech-savvy, you can still use this software with ease. One of the best things about Vidsify is that it supports a wide range of Apple devices and game consoles. You can use it on Macs, iPhones, iPads, iPods, Apple TVs, PlayStation 3s and Xbox 360s. This makes it an incredibly versatile tool for anyone who wants to watch their favorite videos on different devices. Another great feature of Vidsify is its speed. In many cases, the video and audio can be extracted from the original file and copied into a new format that your devices can play without transcoding. This means that no quality is lost during conversion and converting takes seconds rather than minutes. If you're unsure whether a particular video will convert using Vidsify for Mac, there's no need to worry. You can try converting with Vidsify Lite for free first before making any purchase decisions. Vidsify uses H.264 and AAC codecs to ensure high-quality conversions every time. These codecs are known for their ability to produce excellent results while keeping file sizes small. It's important to note that while Vidsify can handle most types of videos files out there; however it cannot convert files protected by DRM (copy-protection). So if you have such files in your collection then unfortunately this software won't be able to help in those cases. Overall though we highly recommend giving Vidisfy a try if you're looking for an easy-to-use yet powerful tool for converting videos into formats supported by all kinds of different devices!
2013-09-30Amacsoft iPad iPhone iPod Disk Mode for Mac
2.1.10Amacsoft iPad iPhone iPod Disk Mode for Mac is a powerful and multifunctional tool that allows you to use your Apple iOS devices as normal USB drives. With this software, you can easily copy files and folders from your iOS devices to your Mac without having to rely on iTunes. This makes it an ideal solution for anyone who wants to manage their files more efficiently. One of the key features of Amacsoft iPad iPhone iPod Disk Mode is its ability to enable your iOS device as a hard disk. This means that you can manage the files contained within it just like you would with any other hard disk on your computer. You can easily move, copy, delete or rename files and folders as needed. Another great feature of this software is its quick search and view functionality. This makes it easy for you to find specific files or folders within your iOS device quickly and easily. You can also preview images, videos, music and other types of media directly within the software itself. Using Amacsoft iPad iPhone iPod Disk Mode is incredibly easy thanks to its intuitive user interface. The software has been designed with simplicity in mind so that even novice users can start using it right away without any difficulty. Overall, if you're looking for a powerful yet easy-to-use tool for managing the contents of your Apple iOS devices on a Mac computer, then Amacsoft iPad iPhone iPod Disk Mode is definitely worth checking out!
2012-11-19iConvert HD for Mac
1.0.0iConvert HD for Mac is a powerful video conversion software that allows you to convert your video files to iPhone, iPod or iPad with ease. With its simple and smart interface, iConvert HD makes it easy for anyone to convert their videos quickly and efficiently. One of the highlights of iConvert HD is its drag and drop feature. This means that you can simply drag your multimedia files into the software and start converting them right away. Additionally, iConvert HD supports batch conversion, which means that you can convert multiple files at once without having to wait for each one individually. Another great feature of iConvert HD is its support for most input video formats. Whether you have AVI, WMV, MOV or any other format, iConvert HD can handle it all. And with its built-in preview player, you can even watch your videos before converting them. iConvert HD also offers an option to convert from/to audio-only music files. This means that if you have a music file in a format that's not supported by your device (such as FLAC), you can easily convert it using iConvert HD. One of the best things about iConvert HD is how easy it is to use. To get started with the software, all you need to do is add your multimedia files into the program and select your device (iPhone/iPod/iPad). From there, simply adjust the file size/quality slider according to your preferences and click "convert". Your converted videos will then be automatically added into iTunes library ready for syncing. But what really sets iConvert apart from other video converters on the market today is its ability to optimize video files specifically for each device in MP4 format. This ensures that every video looks great on whatever device it's played on - whether it's an iPhone 11 Pro Max or an older iPod Touch model. And if all this wasn't enough already - there's more! For a limited time only, users can download iConvert HD at a special price of only $5.99! So why wait? Download now and start enjoying high-quality videos on all your Apple devices today!
2012-04-28FilmTrik BroadCast Batch Converter Professional for Mac
1.0FilmTrik BroadCast Batch Converter Professional for Mac is a powerful video software that simplifies the process of converting hundreds of files from various sources and formats. This ultimate batch converter is used by professional editors from all around the world, taking away the hassle of converting media files. With FilmTrik Pro, you can select a few folders, and it will find all media files within and sort them by their type. You can then assign an export profile either to all or selected files. The way it works is just so easy to use that even beginners can navigate through it with ease. One common problem faced by video editors is playing native camera footage in editing apps, which can be extremely slow. What seems to work with a few files on the timeline will become sluggish when you have more files in a complex sequence. FilmTrik Pro solves this problem by providing an efficient way to convert clips from various sources. Most converters lack folder selection and search before conversion, making it difficult for users to locate specific clips. Additionally, most converters are closed systems that do not allow for fine tweaking of codec parameters. Only if you handle FFmpeg as the ultimate command-line conversion tool can you see the power of tweaking ALL codec parameters. Now everyone can access the power of FFmpeg without writing scripts or complex batch files for command-line execution. To make it even easier, searching ability of FilmTrik Batch Pro supports recursive searching so you will never lose some clip just because it was saved in some rarely accessed folder. Recursive Searching allows users to search whole folders partitions or disks easily while Folder Structure Recreated at destination ensures that your converted videos are organized properly at their destination folder. Another great feature offered by FilmTrik Pro is its ability to create your own Codec Preset and share it with others using FFmpeg as conversion engine. This means that users have complete control over how their videos are converted without having to rely on pre-set options provided by other converters. FilmTrik BroadCast Batch Converter Professional for Mac also offers Windows versions (Windows version still not released as planned in Jan 2013). With its user-friendly interface and powerful features, this software has become an essential tool for professional video editors who want complete control over their video conversions. Key Features: 1) Ultimate Batch Converter: Simplifies converting hundreds of media files from various sources/formats. 2) Easy-to-use Interface: Select few folders & assign export profile either to all or selected file. 3) Efficient Conversion: Solves problems faced while playing native camera footage in editing apps. 4) Folder Selection & Search Before Conversion: Allows locating specific clips easily. 5) Fine Tweaking Of Codec Parameters: Provides complete control over how videos are converted. 6) Recursive Searching: Supports recursive searching so no clip gets lost due to being saved in rarely accessed folder 7) Folder Structure Recreated At Destination: Ensures proper organization at destination folder 8) Create Your Own Codec Preset And Share It With Others 9) Available For Both Mac And Windows Versions
2012-12-21Pavtube Media Magician for Mac for Mac
V1.0.0Pavtube Media Magician for Mac is a powerful and intuitive video software designed specifically for Mac users. This camcorder assistant application is equipped with a smart camcorder wizard that helps automatically connect your camcorder, choose, backup, and import your camcorder footages with ease. With Pavtube Media Magician for Mac, you can easily edit your videos using the timeline editing feature. This feature allows you to accurately cut and trim clips frame by frame. You can also losslessly join MTS/M2TS/MOD/TOD to their original format or MKV. Additionally, you can add 3D and special effects to video clips or adjust volume/brightness/contrast/saturation. This software outputs Apple ProRes MOV for FCP, AIC for iMovie/FCE, WMV/MPG for Adobe Premiere and more. It also helps upload files directly to YouTube in either MP4 or WebM format. One of the key features of Pavtube Media Magician for Mac is its ability to import not only camcorder MTS/M2TS/MXF/MOD/TOD/MOV but also MKV/TiVo/WMV/AVI files. This means that you can easily import all types of video files into this software without any hassle. The media library export and import option in this software helps save resource lists for fast imports. With the task list feature, you can output multiple files with different formats at one time. This makes it easy to output videos with different formats suitable for different usage scenarios. Pavtube Media Magician for Mac comes equipped with preset formats suitable for editing software such as FCP/iMovie/Avid as well as tablets/phones such as Android/iOS/Win 8 RT devices. The timeline editing feature in this software makes it accurate and easy to trim and cut videos according to your preferences. You can also use the multi-task converting feature which outputs videos with different formats at one time. In addition to all these features mentioned above, Pavtube Media Magician allows volume enlarging/reducing options along with video flipping capabilities which make it an all-in-one solution when it comes down to video editing on a mac device. Overall, if you are looking out there on the market today searching high-quality video editing tools then look no further than Pavtube Media Magician! Give it a try today; we guarantee that once you start using this powerful toolset - there will be no turning back!
2013-01-03ReelNQ for Mac
1.95 (v32)ReelNQ for Mac: The Ultimate Video Conversion Tool Are you tired of manually converting your video files one-by-one? Do you need a reliable and efficient tool to convert batches of videos automatically? Look no further than ReelNQ for Mac, the ultimate video conversion software. With ReelNQ, you can easily convert batches of movies with just a few clicks. Simply add your movies by dragging and dropping them onto the queue table, configure your conversion options, and start the queue. ReelNQ will then convert each movie one-by-one until the end of the queue is reached. But that's not all - with ReelNQ, you can also add more movies to the queue while it's running. This means that you can continue adding new videos as needed without having to stop and restart the conversion process. One of the best features of ReelNQ is its ability to easily configure your conversion options. You can choose from a variety of presets for iPhone, iPod, Apple TV, QuickTime, or customize your own settings based on your specific needs. This allows you to ensure that each converted movie meets your exact specifications. In addition to its powerful conversion capabilities, ReelNQ also offers several other useful features. You can preview movies before converting them to ensure they are exactly what you want. You can also display a log of conversions so that you always know which movies have been converted and when. Another great feature is the movie info panel which displays important information about each movie such as file size and duration. This makes it easy to keep track of all your videos in one place. And if all these features weren't enough already - all features are available in demo mode! So even if you're not ready to commit just yet, give it a try and see how easy it is! Finally - let's talk about ease-of-use! With drag-and-drop support for adding movies to the queue table - using this software couldn't be easier! So why wait? Download ReelNQ today and start converting batches of videos automatically with ease!
2011-07-23StarFire for Mac
1.11StarFire for Mac – The Ultimate Video Encoding Software Are you tired of struggling with video files that won't play on your favorite devices? Do you want to create high-quality videos that look great on any screen? Look no further than StarFire for Mac, the ultimate video encoding software. With StarFire, you can easily encode your favorite video files to play on iPod, iPhone, iPad, AppleTV and PlayStation. You can also export your videos in custom formats such as MPEG-2, MPEG-4, H.264, FLV, DV and DivX. Whether you're a professional videographer or just someone who loves making home movies, StarFire has everything you need to create stunning videos that look great on any device. One of the standout features of StarFire is its ability to correct colors and reduce noise in your video files. This means that even if your original footage was shot in less-than-perfect conditions (such as low light or with a shaky camera), StarFire can help make it look better than ever before. With just a few clicks of the mouse, you can transform dull or grainy footage into something truly spectacular. Another great feature of StarFire is its support for SRT subtitles files. If you're creating videos in multiple languages or want to add captions for accessibility reasons, this feature makes it easy to do so without having to use separate software programs. Finally, one of the most useful features of StarFire is its ability to cut videos with start and stop points. This means that if there are parts of your footage that aren't relevant (such as long pauses or mistakes), you can easily remove them without having to re-encode the entire file from scratch. Overall, if you're looking for an all-in-one solution for encoding and editing video files on Mac OS X, then look no further than Starfire! With its powerful features and intuitive interface, it's sure to become an essential tool in any videographer's toolkit.
2010-07-25Enolsoft Video Converter for Mac for Mac
3.10.0Enolsoft Video Converter for Mac: The Ultimate Solution for All Your Video Conversion Needs Are you tired of struggling with incompatible video formats on your Mac? Do you want to enjoy your favorite videos on multiple devices without any hassle? Look no further than Enolsoft Video Converter for Mac – the all-in-one solution for all your video conversion needs. Enolsoft Video Converter for Mac is a powerful and versatile program that allows you to convert between any video formats on Mac, including AVI, WMV, MKV, AVCHD, FLV, MOV and more. With this software at your fingertips, you can easily convert videos to any format that suits your needs – whether it's for playback on a specific device or sharing with friends and family. One of the standout features of Enolsoft Video Converter is its ability to convert videos into formats that are compatible with many portable devices like Kindle Fire, NOOK, iPad, iPhone, iPod, PSP and Xbox 360. This means that you can take your favorite movies or TV shows with you wherever you go – whether it's on a long flight or during a daily commute. But Enolsoft Video Converter isn't just about converting videos into different formats. It also allows users to extract audio from their favorite videos in MP3,WAV,M4A,AIFF format. This feature comes in handy when users want to listen to music from their favorite movies or TV shows without having to watch them. Another great feature of Enolsoft Video Converter is its ability to edit videos by cropping,trimming,and adding watermark. These editing tools allow users not only change the format but also customize their video according their preference. Enolsoft Video Converter has an intuitive interface which makes it easy even for beginners who have never used such software before.The software supports batch conversion which saves time by allowing users convert multiple files at once instead of one file at a time. In conclusion,enjoying high-quality video content shouldn't be limited by compatibility issues.EnolsoftVideoConverterforMac provides an easy-to-use solution that enables anyone regardless of technical expertise,to enjoy their favourite content anytime anywhere.So why wait? Download EnolsoftVideoConverterforMac today!
2012-10-31Prism Plus for Mac for Mac
9.28Prism Plus for Mac is a powerful video file converter that allows you to convert your videos into various formats such as avi, mov, 3gp and more. This software is designed specifically for Mac OS X users who need to convert their video files quickly and easily. With Prism Plus for Mac, you can batch convert thousands of video files at once, preview output files before converting them, add video files directly from DVDs and set compression/encoder rates of output files. One of the best things about Prism Plus for Mac is its ease of use. The software has a simple interface that makes it easy to navigate even if you are not tech-savvy. All you need to do is add the videos you want to convert to the list, select the format you want to use and click on the "convert" button. The software will take care of everything else. Another great feature of Prism Plus for Mac is its ability to set resolution and frame rate of output files. This means that you can customize your videos according to your needs without compromising on quality or size. Prism Plus for Mac also allows you to add it directly into your right-click menu which makes it easy access whenever needed. If you are looking for a reliable video file converter that can handle all types of formats with ease then look no further than Prism Plus for Mac!
2022-06-27ZippyConverter Lite for Mac
1.0.5ZippyConverter Lite for Mac: The Ultimate Video and Audio Converter Are you tired of struggling to find a video or audio converter that can handle all your needs? Look no further than ZippyConverter Lite for Mac, the ultimate solution for converting most common video and audio formats. This lite version of ZippyConverter brings all the power and versatility of its full-featured counterpart at a fraction of the cost. With ZippyConverter Lite, you can easily convert your videos and audios to be compatible with iPod, iPhone, AppleTV, iPad, Xbox 360, PSP, MKV, MP4, MP3, AAC, AIFF and WAV. H.264 encoding is also available for high-quality output. Whether you need to convert a movie file or an audio track from one format to another – ZippyConverter has got you covered. Improved Video and Audio Conversion ZippyConverter Lite offers improved video and audio conversion capabilities compared to other converters on the market. With updated MP4 and MKV support added in this version – it’s easier than ever before to convert your favorite movies or TV shows into formats that are compatible with any device. When ripping a DVD using ZippyConverter Lite – you can add metadata information such as title name or artist name directly into the resulting file. This makes it easy to organize your media library without having to manually enter information later on. Maximum Compatibility Guaranteed ZippyConverter uses ffmpeg (a popular open-source multimedia framework), mencoder (a command-line tool used for encoding videos) as well as QuickTime engines in order to ensure maximum compatibility across different devices. For instance – ffmpeg has a ton of codecs built-in but often there are files that may have trouble depending on how they were encoded in the first place. Installing Perian plug-in for QuickTime ensures that any video that QuickTime can play will be converted by ZippyConverter without any issues whatsoever! Additionally - installing Flip4Mac will introduce Windows Media file decoding while RealPlayer 9 codecs will decode RealPlayer files playable in QuickTime making them easily usable when building DVDs. Auto Detection Methods Zippyconverter uses auto-detection methods which help determine which files may have trouble during conversion process so users don't have worry about anything else except enjoying their media content! Conclusion: In conclusion - if you're looking for an easy-to-use yet powerful video/audio converter then look no further than Zippconverter Lite! With its wide range of supported formats including H264 encoding capabilities along with improved conversion features like updated MP4/MKV support added metadata options when ripping DVDs etc., this software is perfect choice anyone who wants hassle-free experience while converting their media content into desired format(s).
2010-09-014Media iPad Video Converter for Mac
7.8.18.201609134Media iPad Video Converter for Mac is a powerful video conversion software that allows you to convert all sorts of video and audio formats into iPad-compatible formats. With this software, you can easily convert high-definition (HD) videos, including AVCHD (*.mts, *.m2ts), H.264/MPEG-4 AVC, into iPad H.264 HD videos. In addition to HD video conversion, 4Media iPad Video Converter for Mac also supports the conversion of general video and audio formats such as AVI, MPEG, WMV, DivX, MP4, MOV, RMVB and more. You can use this software to convert these formats into iPad-compatible videos (H.264 or MPEG-4) or music files (MP3,WAV,AAC or AIFF). The user-friendly interface of 4Media iPad Video Converter for Mac makes it easy to use even if you are not familiar with video conversion software. The intuitive interface allows you to drag and drop files directly into the program window for quick conversion. One of the key features of 4Media iPad Video Converter for Mac is its ability to customize output settings according to your preferences. You can adjust parameters such as resolution,brightness,saturation,and contrast before converting your videos. Another great feature of this software is its batch processing capability which allows you to convert multiple files at once without any loss in quality. Overall,this powerful yet easy-to-use software provides a convenient solution for anyone looking to enjoy their favorite videos on their iPads without any compatibility issues. Key Features: 1.Supports decoding all sorts of video and audio formats including high-definition (HD) videos. 2.Convert HD video files (AVCHD (*.mts,*m2ts),H.264/MPEG-4 AVC)into iPad H.264 HD videos. 3.Convert general video and audio formats(AVI,MPEG, WMV, DivX, MP4, MOV,RM,RMVB, ASF, 3GP,WMA, RA,and etc.)toiPadvideos(H. 264,MPEG- 4 )ormusic(MP3,WAV,AACorAIFF). 5.Customize output settings according toyour preferences. 6.Batch processing capability which allowsyouconvertmultiplefilesatoncewithoutanylossinquality. 7.User-friendlyinterfacewhichmakesiteasytouseevenifyouarenotfamiliarwithvideoconversionsoftware. System Requirements: Operating System:MacOS X v10. 6 -10. 15(Sierra) Processor:Intel® processor RAM:512MB RAM Free Hard Disk Space:100MB free hard disk spacefor installation Graphics Card:Super VGA(800×600)resolution;16-bit graphics cardor higher Conclusion: Ifyouarelookingforapowerfulyetuser-friendlysoftwarethatcanconvertallkindsofvideosandaudiosintoiPadcompatibleformats,youcannotgowrongwiththe 4MediaiPadVideoConverterforMac.Withitscustomizableoutputsettingsandbatchprocessingcapability,thissoftwareprovidesanexcellentwaytoenjoyyourfavoritevideosonyouriPadwithoutanycompatibilityissues.So,giveittrytodayandstartenjoyingyourvideosonthe-go!
2016-09-26iTool MPEG To iPhone Converter For MAC for Mac
1iTool MPEG To iPhone Converter for MAC is a powerful and easy-to-use software that allows you to convert your MPEG-1, MPEG-2, DAT (the video format used in VCD, SVCD), and VOB (the video format used in DVD) files to iPhone video format. With this software, you can also extract audio files of AVI video formats into MP3 or M4A for your iPhone. This software is designed specifically for Mac users who want to enjoy their favorite videos on their iPhones. It offers a simple and intuitive interface that makes it easy to use even if you have no prior experience with video conversion software. One of the key features of iTool MPEG To iPhone Converter for MAC is its ability to convert multiple file formats into one compatible with the iPhone. This means that you can easily transfer all your favorite videos from your computer onto your phone without having to worry about compatibility issues. Another great feature of this software is its ability to extract audio files from AVI videos. This means that you can now enjoy all your favorite music on your iPhone without having to download separate audio files. The conversion process itself is fast and efficient thanks to the advanced algorithms used by iTool MPEG To iPhone Converter for MAC. You can expect high-quality output every time, regardless of the size or complexity of the original file. Overall, iTool MPEG To iPhone Converter for MAC is an excellent choice if you're looking for a reliable and user-friendly tool that will help you convert all your favorite videos into a format compatible with your iPhone. Whether you're a casual user or an experienced professional, this software has everything you need to get started right away. Key Features: 1) Convert multiple file formats: iTool MPEG To iPhone Converter for MAC supports converting various file formats such as MPEG-1, MPEG-2, DAT (the video format used in VCD, SVCD), and VOB (the video format used in DVD) into one compatible with the iPhone. 2) Extract audio files: With this software's ability to extract audio files from AVI videos; users can now enjoy all their favorite music on their iPhones without downloading separate audio files. 3) Fast conversion process: The advanced algorithms used by iTool MPEG To iPhone Converter ensure fast and efficient conversions every time. 4) High-quality output: Regardless of the size or complexity of the original file; users can expect high-quality output every time they use this tool. 5) User-friendly interface: The simple yet intuitive interface makes it easy even for beginners who have no prior experience using similar tools. 6) Compatibility: This version works perfectly well on Mac computers running OS X 10.6 Snow Leopard or later versions. How Does It Work? Using iTool MPEG To IPhone Converter For Mac couldn't be easier! Here's how it works: Step 1 - Download And Install Firstly download & install "iTool_MPEG_To_iPhone_Converter_For_Mac.dmg" package from our website https://www.itoolmac.com/mpeg-to-iphone-converter-for-mac.html Step 2 - Add Files Click "Add File" button located at top left corner then select any supported input media type like. mpg/.mpeg/.dat/.vob etc., which needs conversion then click "Open". Step 3 - Choose Output Format Select desired output media type like. mp4/.m4v etc., which are supported by Apple devices like iPod/iPhone/iPad/Apple TV etc., under "Profile" drop-down list located at bottom left corner then choose destination folder where converted media will be saved after completion under "Destination" field located at bottom center part then click "Convert". Step 4 - Start Conversion Process After clicking Convert button wait until progress bar reaches end point indicating successful completion message appears. Conclusion: In conclusion; we highly recommend using iTool_MPEG_To_iPhone_Converter_For_Mac as it provides an excellent solution when converting various types of media content such as MPG/MPEG/DAT/VOB etc., into Apple device friendly MP4/M4V formats while maintaining high quality standards throughout entire process making sure final product looks great on any device screen size whether small handheld devices like iPod/iPhone/iPad/Apple TV etc., large desktop monitors/laptops screens too!
2008-11-07iTool Video To Audio Converter For MAC for Mac
1iTool Video To Audio Converter For MAC for Mac is a powerful and easy-to-use software that allows you to extract audio from various video formats. With this software, you can convert AVI, WMV, ASF, MPG/MPEG, MP4, MOV, 3GP files to MP3, WAV or AAC format. This software is perfect for those who want to extract audio from their favorite movies or music videos. The iTool Video To Audio Converter For MAC for Mac supports fast batch conversion. You can convert several sections of a video file at once. This feature saves you time and effort as you don't have to convert each section separately. This software also supports rich options that allow you to generate audio files with different qualities and sizes. You can choose the quality of the output file based on your needs. The iTool Video To Audio Converter For MAC for Mac also allows you to adjust the volume of the output file. One of the best things about this software is its user-friendly interface. Even if you are not familiar with video conversion tools, this software is easy to use and navigate through its features. The iTool Video To Audio Converter For MAC for Mac has been designed specifically for Mac users. It works seamlessly on all versions of macOS including Catalina and Big Sur. This version of iTool Video To Audio Converter For MAC for Mac is the first release on CNET Download.com which means it has been tested by millions of users worldwide and has received positive feedback from them. In conclusion, if you are looking for an easy-to-use tool that allows you to extract audio from various video formats then look no further than iTool Video To Audio Converter For MAC for Mac!
2008-11-07Episode for Mac
6.4.3If you're looking for a powerful video encoding software that can handle a wide range of formats, Telestream Episode 6 is the perfect solution. This all-in-one application is designed for post-production and new media workflows, making it an essential tool for anyone who needs to encode video content quickly and efficiently. One of the standout features of Episode 6 is its cross-platform compatibility. Whether you're using a desktop computer, workgroup cluster or dedicated server farm, this software encoder can scale to meet your needs. This makes it an ideal choice for businesses and organizations that need to process large volumes of video content on a regular basis. Another key advantage of Episode 6 is its support for multiple file formats. Unlike other encoders in its class, this software can accept and transcode more video and audio file formats than any other encoder on the market. This means you won't have to worry about compatibility issues when working with different types of media files. In addition to its broad format support, Episode 6 also offers best-in-class video processing capabilities. With full 10-bit support and fine-tuning compression capabilities, you'll be able to generate excellent picture quality every time. Whether you're encoding high-definition footage or standard definition content, this software will help ensure your videos look their best. But that's not all - Episode 6 also includes several advanced features that allow you to enhance and protect your video content even further. For example, bumpers and trailers can be added at the beginning or end of your videos to provide additional branding opportunities or promote related content. Watermarks can also be added throughout your videos as an extra layer of protection against unauthorized use. Overall, Telestream Episode 6 is an exceptional piece of software that offers unparalleled flexibility and performance when it comes to encoding video content. Whether you're working in post-production or new media workflows, this application has everything you need to get the job done quickly and efficiently while maintaining high-quality output every time.
2014-04-25Swift Converter for Mac
3.2.0Swift Converter for Mac: The Ultimate Video Utility Tool Are you tired of struggling with video and audio formats that just won't cooperate? Do you need a reliable tool to help you convert your media files quickly and easily? Look no further than Swift Converter for Mac, the ultimate video utility tool. With Swift Converter, you can effortlessly convert formats from video to video, video to audio, and audio to audio. Whether you're working with WMV, RM, RMVB, MPG, AVI, MKV, MOV, FLV, MP4 or any other format under the sun - Swift Converter has got you covered. But that's not all. With Swift Converter's powerful editing tools at your fingertips - including split/trim functions and the ability to add watermarks or crop videos - it's never been easier to customize your media files exactly how you want them. And if that wasn't enough already - Swift Converter also allows for easy conversion of any format directly onto your Apple device. That means whether it's an iPod or iPhone 4 or even a new iPad - converting your favorite media files has never been simpler. But what about those times when all you really need is the audio content from a particular file? No problem! With Swift Converter's advanced extraction capabilities - extracting and converting only the audio content from any given file is quick and easy. Supported Encoding Codecs: x264(H264), XVid,MPEG4, FLV,MPEG, MP2, AC3, MP3,AAC,WMAV1,WMAV2, WMV1, WMV2 And if all of this sounds too good to be true- don't worry! We've got plenty more features up our sleeve. For example- iBooks Author videos are fully supported by our software- so creating engaging multimedia content has never been easier! So why wait? Download Swift Converter today and start enjoying hassle-free conversions in no time!
2018-09-18iTool AVI To iPhone Converter For Mac for Mac
1iTool AVI To iPhone Converter For Mac: The Ultimate Video Conversion Solution Are you tired of struggling with video conversion software that produces poor quality output? Do you want a reliable and efficient tool that can convert your AVI videos to iPhone-compatible formats without any hassle? Look no further than iTool AVI To iPhone Converter For Mac! This powerful video conversion software is designed specifically for Mac users who want to convert their AVI videos to MP4, AAC, and MP3 formats compatible with their iPhones. With its advanced features and intuitive interface, iTool AVI To iPhone Converter For Mac makes it easy for anyone to convert their videos quickly and efficiently. Key Features: - High-quality output: iTool AVI To iPhone Converter For Mac uses advanced algorithms to ensure that the converted videos have excellent sound and image quality. You can enjoy your favorite movies on your iPhone without any loss of quality. - Fast conversion speed: This software is optimized for multi-core processors, which means it can convert your videos at lightning-fast speeds. You won't have to wait long before you can start enjoying your converted files on your iPhone. - Easy-to-use interface: The user-friendly interface of iTool AVI To iPhone Converter For Mac makes it easy for anyone to use this software. Even if you're not tech-savvy, you'll be able to navigate through the menus and options easily. - Batch conversion: If you have multiple files that need converting, don't worry! This software supports batch conversion so that you can convert all of them at once. - Customizable settings: You can customize the output settings according to your preferences. Choose from different resolutions, bitrates, frame rates, audio channels, etc., depending on what works best for you. How It Works: Using iTool AVI To iPhone Converter For Mac is simple! Here's how: 1. Download and install the software on your Mac computer. 2. Launch the program. 3. Click "Add File" or "Add Folder" button in the main interface or drag-and-drop files directly into the program window. 4. Select an output format from the drop-down menu under "Profile." 5. Click "Convert" button in lower right corner of main window. 6.Wait until process completes 7.Transfer converted file(s) onto device System Requirements: To use iTool AVI To iPhone Converter For Mac effectively, make sure that your system meets these requirements: - Operating System: macOS 10.x or later - Processor: Intel processor - RAM: 512 MB or more - Hard Disk Space: 50 MB free space Conclusion: If you're looking for a reliable video converter tool that produces high-quality output while being easy-to-use at an affordable price point then look no further than iToolAVIToiPhoneConverterForMac! With its advanced features like fast conversions speeds & customizable settings along with intuitive user-interface make this product perfect choice when converting avi files into iphone compatible formats such as mp4,aac,and mp3. So why wait? Download now & start enjoying all those great movies & TV shows today!
2008-11-07Bigasoft Total Video Converter for Mac for Mac
5.1.1.6250Bigasoft Total Video Converter for Mac is a versatile and powerful media converter that allows you to edit and convert video, audio, and animated images. With its advanced features, this software is an all-in-one solution for your multimedia needs. As a powerful converter, Bigasoft Total Video Converter can convert between various video and audio formats with ease. It supports popular formats such as MP4, AVI, MOV, WMV, MKV, FLV, 3GP, VOB and more. You can also convert audio files to different formats like MP3, WAV or AAC. One of the standout features of Bigasoft Total Video Converter is its advanced editing functions. You can trim videos to remove unwanted parts or merge multiple clips into one file. The software also allows you to add effects to pictures or videos such as brightness adjustment or color correction. Adding watermarks and subtitles is easy with Bigasoft Total Video Converter too. You can customize the font style and size of your subtitles as well as adjust their position on the screen. Additionally, you have the option to remove or replace audio tracks in your videos. Extracting audio from videos has never been easier thanks to this software's built-in feature that lets you extract soundtracks from movies in just a few clicks. You can also extract pictures from videos if needed. Bigasoft Total Video Converter for Mac makes it easy for you to play any incompatible movie/music file on your iPad/iPhone/iPod/AppleTV/iTunes/QuickTime/iMovie/Final Cut/Windows Phones/Android phones without any hassle. Overall this software offers an impressive range of features that make it an excellent choice for anyone looking for a comprehensive media converter solution. Key Features: - Convert between various video/audio formats - Advanced editing functions including trimming & merging - Add effects like brightness adjustment & color correction - Add watermarks & subtitles with customizable fonts & positions - Remove/add/replace audio tracks in videos - Extract soundtracks/pictures from movies easily - Compatible with iPad/iPhone/iPod/AppleTV/iTunes/QuickTime/iMovie/Final Cut/Windows Phones/Android phones System Requirements: Mac OS X v10.5 - 10.15 (Catalina) Intel processor; PowerPC G5 processor or above; 512MB RAM; 50MB free hard disk space for installation; Super VGA (800 x 600) resolution; 16-bit graphics card or higher Conclusion: In conclusion,Bigasoft Total Video Converter is an excellent choice if you're looking for a comprehensive media converter solution that offers advanced editing functions along with support for multiple video/audio formats.The ability to extract soundtracks/pictures from movies easily makes it stand out among other similar products on the market.Its compatibility with various devices including iPad,iPhone,iPod etc makes it even more appealing.So if you want a reliable tool that will help you manage all your multimedia files efficiently then look no further than Bigasoft Total Video Converter!
2017-03-02Wondershare UniConverter for Mac
14.0Wondershare UniConverter for Mac: The Ultimate Video Software Are you tired of struggling with video files that won't play on your device? Do you want to edit and compress your videos without losing quality? Look no further than Wondershare UniConverter for Mac, the ultimate video software that can handle all your needs. With Wondershare UniConverter, you can convert any video or audio file to over 1000 formats, including MP4, MOV, AVI, and MKV. Whether you're using an Apple device, Android device, VR headset or game console – this software has got you covered. And with APEXTRANS technology powering the conversion process, there's zero quality loss when converting 4K/8K videos. But that's not all – Wondershare UniConverter also offers high-speed conversion mode which converts files at 30X faster speed than contemporaries. You can even batch convert multiple files to one or different formats at one time and pause the audio/video converting process at any time. Video Editing Made Easy Wondershare UniConverter also includes a powerful video editing toolset. Trim unwanted segments from a movie or TV episode or split a long video into multiple clips for sharing and other uses. Merge entire TV series for flawless enjoyment or merge a playlist for seamless playback. You can even speed up or slow down any videos! Using speed controls to highlight important moments in your footage. Turn the volume up or down as needed; decrease background noise; mute clips; enhance your audio track easily – it's all possible with this software. And if you want to add some creative flair to your videos – apply effects in just one click! Add watermarks for copyright protection too! Compress Videos Without Losing Quality Do large video files take up too much space on your hard drive? With Wondershare UniConverter's compression feature - adjust video resolution, bitrate and output format - reducing file size is easy! Compress more than 1,000 video and audio formats in batches while previewing compressed output beforehand! Screen Recording Made Simple Need to record something on-screen? No problem! With Wondershare UniConverter screen recording feature - record any area of your screen without frame rate loss! Record games effortlessly while recording from webcam simultaneously perfect for reactions & tutorials! Record system audio & microphones easily schedule recording tasks anytime switch screens while recording support adding marker lines arrows rectangle painting circle painting undo anti-undo & other operations during recording process! Burn Your DVD Like A Pro Want to burn DVDs like a pro? With Wondershare Uniconverter’s DVD burning feature - burn any video file (including ripped DVDs) onto DVD folders ISOs with free stylish templates included! Choose from numerous free stylish templates unique only available through this software! The Toolbox: More Powerful Features At Your Fingertips In addition to these features mentioned above - there are more powerful features available within the toolbox section of this software: Intelligent Trim: Add image & text watermark remove watermark from videos Watermark Editor: Remove/Add watermarks Subtitle Editor: Make completely custom subtitles easy-to-read look great! GIF Maker: Create animated GIFs from videos/pictures Fix Media Metadata: Auto-fix/edit metadata at will. Image Converter: Convert images popular formats like PNG JPEG TIFF etc. CD Burner Burn M4A FLAC MP3 music files onto CDs! VR Converter Convert Videos To VR Enjoy Them On Your VR Devices! Conclusion: In conclusion,Wondershare Uniconverter is an excellent choice if you need an all-in-one solution that handles everything related to digital media management such as converting editing compressing burning DVDs screen recordings etc.! It’s user-friendly interface makes it easy-to-use even if you’re not tech-savvy person so why wait try it out today!?
2022-07-124Media Download YouTube Video for Mac for Mac
5.6.6.201607014Media Download YouTube Video for Mac is a powerful and easy-to-use video software that allows you to download YouTube videos to your Mac. With its completed functions, you can easily batch download multiple YouTube video files at a time. This software is perfect for anyone who wants to save their favorite videos from YouTube and watch them offline. One of the standout features of 4Media Download YouTube Video for Mac is its stand-alone YouTube video browser. This browser makes it incredibly easy to browse, directly download, and quickly search online YouTube videos. You can simply enter the URL of the video you want to download or use the built-in search function to find what you're looking for. Another great feature of this software is its right-click menu integration. With just one right click of your mouse, you can easily download any YouTube video that catches your eye. This makes downloading videos from YouTube quick and effortless. In addition to these features, 4Media Download YouTube Video for Mac also offers a variety of customization options. You can choose the format in which you want your downloaded videos saved (such as MP4 or FLV), as well as adjust other settings like resolution and quality. Overall, 4Media Download YouTube Video for Mac is an excellent choice if you're looking for an easy-to-use tool that lets you quickly and easily download your favorite videos from one of the most popular websites on the internet. Key Features: - Easy-to-use interface - Stand-alone browser with direct downloading capabilities - Batch downloading support - Right-click menu integration - Customizable output formats System Requirements: To use 4Media Download Youtube Video For Mac on your computer, it must meet certain system requirements: - Operating System: macOS X v10.6 - v10.15 - Processor: Intel processor - RAM: 512MB RAM or more recommended - Free Hard Disk Space: 100MB space required How To Use: Using 4Media Download Youtube Video For Mac couldn't be easier! Here's how: 1) Launch the program by double-clicking on its icon. 2) In the main window, click on "Add URL" button. 3) Copy & paste or drag & drop URLs into pop-up dialog box. 4) Choose output format according to personal preference. 5) Click "Download" button in toolbar. Conclusion: If you're looking for a reliable tool that lets you quickly and easily download all kinds of content from Youtube onto your mac device then look no further than 4Media Download Youtube Video For Mac! With its user-friendly interface, customizable output formats options along with batch downloading support make it an ideal choice whether youre new at using such tools or have been doing so already but are looking out something better than what's currently available out there!
2016-09-22