Other
ECTmouse
1.13.4ECTmouse - The Ultimate Solution for Limited Motor Functions Are you or someone you know suffering from limited motor functions? Do you find it difficult to use a mouse due to tremors, insufficient hand or arm mobility, impaired fine motor skills, or any other condition that affects your ability to move the cursor and click icons on your computer screen? If so, ECTmouse is the perfect solution for you. ECTmouse is an application that emulates cursor movement and mouse button clicks by using any keyboard. This program is part of the assistive technologies complex and works effectively with a personal computer for those suffering from various forms of paralysis or significantly reduced motor functions. With ECTmouse, users can emulate vertical, horizontal, and diagonal cursor movements; clicks and double clicks (for right, left, or middle buttons); vertical scrolling; separate pressing and release of buttons. This program fits various groups of users with limited motor functions and can be successfully applied in such cases: - Insufficient hand or arm mobility - Impaired fine motor skills when the user can't aim, click icons or any areas of the desktop due to too strong quick intense movements - Tremors when the user can't click on icons due to uncontrolled shifts of the cursor - Hand pains during work with a mouse as a result of carpal tunnel syndrome osteoarthritis various neurological diseases different types of injuries prolonged work at the computer - Diseases which cause temperature exchange problems. In such cases fingertips are too cold which causes some additional problems during touchpad operation. But that's not all! Any person without any limits in motor functions can also use ECTmouse. The most common cases and situations are listed below: - Malfunctions of mouse or laptop touchpad - When it's necessary to work but wireless mouse is charging - To add middle mouse button and scrolling functions (when working with a touchpad which doesn't support such functions or in case two-buttoned mouse operation) - In cases when it's necessary to obtain precise cursor positioning (up to one pixel) to complete various operations and tasks One great feature about ECTmouse is its convenient configuration process. Each mouse action can be assigned to any desired key on the keyboard allowing users configure this program according their personal needs. In conclusion if you're looking for an effective solution that will help improve your productivity while using your computer despite having limited mobility then look no further than ECTmouse!
2015-11-02QZAntics Slug
0.9QZAntics Slug For Windows: A Fun and Effective Way to Slow Down Your System Are you looking for a program that can slow down your system to an absolute crawl? Look no further than QZAntics Slug For Windows. This program is designed for practical jokers, mischief makers, and software testers who want to have some fun at the expense of their favorite developers. With QZAntics Slug For Windows, you can remotely activate the program on a developer's system and watch as their system slows down based on intervals you've set. You can even rename the process to something ultra non-intuitive like 'lcass' or 'mlasst' to make it seem like a system process. And if you're targeting a superstitious developer, try making comments like "Boy, I wonder if you have a ghost in your system." The possibilities for fun are endless. But QZAntics Slug For Windows isn't just for practical jokes. It's also a great way to stress test operating systems and space flight systems for fictional or real-life starships such as Spaceship Two where the main central processing unit might demand real-time support and some errant code pegs the CPU. So how does QZAntics Slug For Windows work? Simply enter parameters at the command line specifying minimum and maximum time intervals between runs of slug, length of time (in seconds) to make machine slow, and length of time (in seconds) to run slug before it self-terminates. This command is best suited for shell execution. But don't worry about causing any permanent damage with QZAntics Slug For Windows. It's just harmless fun that will leave your favorite developers scratching their heads in confusion. In conclusion, if you're looking for a program that can slow down your system in hilarious ways or stress test operating systems and space flight systems, look no further than QZAntics Slug For Windows. Try it out today!
2014-11-13Mouse Statistics Software
7.0Mouse Statistics Software: A Comprehensive Solution for Tracking Mouse Usage Are you curious about how much time you spend using your mouse every day? Do you want to know how many clicks you make in a given period of time? If so, then Mouse Statistics Software is the perfect tool for you. This software offers a comprehensive solution for tracking mouse usage statistics such as distance traveled, number of clicks, speed and location. With this software, you can get a detailed picture of your mouse's activity and use that information to optimize your workflow. Features: - Record mouse usage statistics: This software allows users to record various mouse usage statistics such as distance traveled, number of clicks, speed and location. You can choose which statistics to track based on your needs. - Detailed reports: The software generates detailed reports that show the recorded data in an easy-to-understand format. You can view the reports by day, week or month. - Customizable settings: The software allows users to customize various settings such as recording interval and notification options. You can set up notifications to alert you when certain thresholds are reached. - Easy-to-use interface: The interface is user-friendly and intuitive. Even if you're not tech-savvy, you'll be able to use this software without any problems. Benefits: 1) Optimize workflow - By tracking your mouse activity with this software, you can identify areas where there may be inefficiencies in your workflow. For example, if you notice that it takes longer than usual to complete certain tasks because of excessive clicking or scrolling around the screen aimlessly; then it might be time for some optimization! 2) Improve productivity - With detailed insights into how much time is spent on different tasks throughout the day; users will have better control over their workday schedule which ultimately leads them towards higher productivity levels. 3) Reduce fatigue - By monitoring how often one uses their computer's peripherals like keyboard/mouse; they could take breaks at regular intervals thus reducing eye strain & fatigue caused due prolonged exposure towards screens. Conclusion: In conclusion, Mouse Statistics Software is an excellent tool for anyone who wants to track their mouse usage statistics accurately and efficiently. Whether it's optimizing workflows or improving productivity levels; this utility has got everything covered! So why wait? Download now & start exploring its features today!
2015-07-07Kioware
8.0Kioware is a powerful kiosk software designed to secure your PC or tablet and limit access to only permitted websites and browser-based applications. With its latest update, Kioware now supports Chrome Browser, making it an even more versatile solution for businesses looking to provide self-service options for their customers. As a Utilities & Operating Systems software, Kioware provides a secure self-service solution by locking down the Windows Operating System and limiting access to only cloud-based applications and websites that are permitted. This ensures that users can only access the content that is relevant to them while keeping your system safe from unauthorized access. The KioWare Full for Windows product has two components: client-side kiosk lockdown and a kiosk management server console. The client-side features of KioWare Full for Windows are similar to those of KioWare Basic for Windows software but with additional features such as browser lockdown with the Chromium Browser Engine, keyboard control interface for disabling keyboard keys, domain/page blocking (allow or revoke lists), HTML based toolbar with fully customizable HTML design, virtual keyboard, clearing of cookies/history/print queue at session end, running OS as shell among others. One of the most significant benefits of using Kioware is its simplified configuration options. You can easily customize navigational toolbar skins according to your business needs. Additionally, you can generate attract screens that will help draw attention towards your services or products. Kioware also offers remote XML configuration which allows you to manage multiple devices from one central location without having physical access to each device individually. This feature saves time and resources while ensuring consistency across all devices. Another essential feature offered by Kioware is pop-up management access control list which enables you to block unwanted pop-ups on your device's screen effectively. This feature helps in providing uninterrupted user experience while browsing through different web pages. Kioware also provides automatic printer retraction which ensures that sensitive information does not get left behind on printed documents after use. It also handles mechanisms required placing outgoing phone calls securely without exposing any confidential information about users' identity or contact details. With Kioware's file download blocking feature enabled on your device(s), you can prevent unauthorized downloads from occurring on your system(s). This helps in maintaining data security by preventing malware attacks through downloaded files from untrusted sources online. Multiple monitor support provided by Kioware allows businesses with multiple displays in their premises like retail stores or airports etc., where they need more than one screen displaying different content simultaneously without any interference between them whatsoever! Application resetting provided by this software enables businesses always have fresh content displayed every time someone uses their service/product via these devices - ensuring maximum engagement levels among customers/visitors alike! In conclusion, if you're looking for an efficient way of securing PCs/tablets used in public places like libraries/museums/airports/hospitals etc., then look no further than Kioware! Its robust features make it an ideal choice when it comes down protecting sensitive data against unauthorized usage/accessibility online/offline!
2015-08-03VisualKeys
1.1.0.0VisualKeys - The Ultimate Solution for Keyboard Status Display Are you tired of not knowing whether your Caps Lock or Num Lock keys are on or off? Do you find it frustrating to type in passwords only to realize that the Caps Lock key was on the whole time? If so, then VisualKeys is the perfect solution for you! VisualKeys is a small software utility that displays the status of your Caps Lock and Num Lock keys as icons near your clock. This means that you can always see whether these keys are on or off, without having to guess or test them out. But VisualKeys isn't just about displaying keyboard status. It's also a powerful tool for customizing your keyboard settings and improving your typing experience. With VisualKeys, you can: - Customize the appearance of the keyboard status icons - Choose which keys to display (Caps Lock, Num Lock, Scroll Lock) - Set up hotkeys for toggling these keys on and off - Enable sound notifications when these keys are pressed In addition to these features, VisualKeys also includes a handy "Keyboard Viewer" tool that lets you see all of the characters available on your keyboard. This is especially useful if you're typing in a language other than English or need access to special characters. So why choose VisualKeys over other similar software utilities? Here are just a few reasons: 1. Easy-to-use interface: VisualKeys has an intuitive interface that makes it easy to customize your settings and view keyboard status at a glance. 2. Lightweight and fast: Unlike some other software utilities, VisualKeys won't slow down your computer or take up too much space. 3. Affordable pricing: At MicSoft, we believe in providing high-quality software at an affordable price point. That's why we offer VisualKeys at a competitive price with no hidden fees. 4. Excellent customer support: If you have any questions or issues with our software, our friendly customer support team is always here to help. Overall, if you're looking for an easy-to-use and customizable solution for displaying keyboard status and improving your typing experience, then look no further than VisualKeys from MicSoft!
2015-10-26DeskRule
1.2.0.4DeskRule: The Ultimate Desktop Search Engine Are you tired of searching for files on your desktop using only the basic filename or file content search? Do you want to find specific files based on their properties, such as author, tags, or even GPS location? Look no further than DeskRule – the ultimate desktop search engine. DeskRule is a powerful utility software that helps you find anything and everything on your desktop. With over 300 available system properties to search from, DeskRule can locate any file based on its attributes. Whether it's top-rated pictures, audio tracks by artist, PDF/Office documents by tags or author, photos shot in Australia (GPS), photos of your kids (People), DLLs installed by Microsoft (Company), and more – DeskRule has got you covered. Unlike other desktop search engines that rely solely on the Windows Search Index for speed and accuracy, DeskRule has its own robust search engine as a backup. This ensures that if the document is there somewhere, it will be found for you! Plus, with its fully shell-integrated design, you can act on the files found just like in your Windows Explorer. But what sets DeskRule apart from other desktop search engines is its ability to show a preview of all documents found with all attributes queried for. This feature helps users understand their results better and saves time when looking through multiple files. With DeskRule's user-friendly interface and advanced features like Boolean operators and wildcards support in queries – finding what you need has never been easier! Key Features: - Searches using over 300 available system properties - Uses Windows Search Index for speed - Has its own robust backup search engine - Shows previews of documents found with all attributes queried for - Fully shell-integrated design allows users to act on files found like in Windows Explorer - User-friendly interface with advanced features like Boolean operators and wildcards support In conclusion: DeskRule is an essential tool for anyone who wants to save time searching through their desktop clutter. Its advanced features make it easy to find any file based on specific attributes quickly. With its user-friendly interface and powerful capabilities – this software is perfect for both personal use at home or professional use at work. So why wait? Download DeskRule today!
2016-02-09MouseTrap
1.0.2210.3MouseTrap is a powerful utility software that falls under the category of Utilities & Operating Systems. It is designed to work with all versions of Windows and the WINE Windows emulator. The software has been developed by GRC, a renowned name in the world of software development. The primary function of MouseTrap is to determine whether the Windows system under test will execute arbitrary code contained within specially formatted metafile images. This makes it an essential tool for anyone who wants to ensure that their system is secure and protected against potential threats. One of the most significant advantages of MouseTrap is its compatibility with all versions of Windows, including older versions like Windows XP and Vista. This means that users can use this utility on any computer running any version of Windows without worrying about compatibility issues. Another great feature of MouseTrap is its ease-of-use. The software has been designed with simplicity in mind, making it easy for even novice users to navigate and use effectively. The user interface is intuitive and straightforward, allowing users to quickly access all features and functions without any hassle. MouseTrap also comes equipped with advanced security features that help protect your system from potential threats. For example, it includes a built-in firewall that helps block unauthorized access attempts from external sources such as hackers or malware attacks. In addition to its security features, MouseTrap also offers several other useful utilities such as disk cleanup tools, registry cleaners, file shredders, and more. These tools help optimize your system's performance by removing unnecessary files and programs while freeing up valuable disk space. Overall, if you're looking for a reliable utility software that can help keep your system secure while optimizing its performance at the same time, then MouseTrap should be at the top of your list. With its advanced security features combined with easy-to-use utilities like disk cleanup tools and registry cleaners – this software has everything you need to keep your computer running smoothly!
2014-12-11WyeSoft LockLock
1.0WyeSoft LockLock is a powerful utility that can help you manage your keyboard lock keys with ease. If you're someone who regularly hits the Caps Lock, Num Lock or Scroll Lock keys by mistake, or if you use them for other functions such as push-to-talk in games or voice communication clients, then WyeSoft LockLock is the perfect solution for you. This simple yet effective utility allows you to lock any of these three keys in a particular state permanently. You can choose to keep them on or off depending on your preference and usage. This means that once locked, these keys will remain in their designated state until unlocked manually. WyeSoft LockLock is designed to be easy to use and requires no technical knowledge whatsoever. Simply download and install the software on your computer, and it's ready to go. The user interface is intuitive and straightforward, making it easy for anyone to get started right away. One of the best things about WyeSoft LockLock is its versatility. It works with all versions of Windows operating systems from Windows XP onwards, so no matter what version of Windows you're using; this software will work seamlessly without any issues. Another great feature of WyeSoft LockLock is its ability to run silently in the background without affecting system performance or causing any interruptions while working on other tasks. This means that once set up correctly, it won't interfere with your daily workflow at all. In addition to its primary function of locking keyboard lock keys permanently, WyeSoft LockLock also offers some additional features that make it even more useful: - Auto-start: You can configure WyeSoft LockLock always to start automatically when Windows starts up. - Tray icon: The software comes with a tray icon which provides quick access to all settings. - Hotkeys: You can assign hotkeys for locking/unlocking each key individually. - Customization: You can customize various aspects such as colors and sounds according to your preferences. Overall, WyeSoft LockLock is an excellent utility tool that offers a simple yet effective solution for managing keyboard lock keys efficiently. Its ease-of-use combined with its versatility makes it an ideal choice for anyone looking for an efficient way of managing their keyboard locks without any hassle whatsoever. So if you're tired of accidentally hitting those pesky Caps/Num/Scroll locks while typing away at your computer or need them locked permanently while gaming or communicating online - give WyeSoft's innovative new tool a try today!
2014-11-06Atom Imp File Search
1.02Atom Imp File Search is a powerful utility software that falls under the category of Utilities & Operating Systems. It is designed to help users search for files on their computer system with ease and efficiency. The software uses a separate thread for minimum system impacts, ensuring that it does not slow down your computer while searching. With Atom Imp File Search, you can search all the files in a folder and optionally all the files in the tree of sub-folders for the existence of a text search expression in the file names and/or the files textual content. This means that you can easily find any file on your computer by simply typing in its name or part of its content. The software comes with various search options to make your search even more specific and accurate. You can choose to search using literal text, wildcards, or a regular expression depending on your preference. Additionally, you can choose to make your searches case sensitive or case insensitive depending on what works best for you. Atom Imp File Search also allows you to restrict or expand default textual file types during searches. This means that if you only want to look for specific types of files such as PDFs or Word documents, you can easily do so without having to sift through irrelevant results. Another great feature of Atom Imp File Search is its ability to limit search parameters based on size and date range. This makes it easier for users who are looking for specific files created within certain time frames or those above certain sizes. Once your search is complete, Atom Imp File Search provides an easy way for users to inspect their results in programs of their choosing such as Notepad++, Microsoft Word among others. This ensures that users have access to their results without having to switch between different applications. In addition, Atom Imp File Search comes with an extensive help system including links to video tutorials which makes it easy even for beginners who may not be familiar with how utilities work. Overall, Atom Imp File Search is an excellent utility software designed specifically with user convenience in mind. Its powerful features coupled with its ease-of-use make it an essential tool every computer user should have installed on their systems!
2016-06-15GazeRecorder
1.9GazeRecorder - Eye Tracking Software for Enhanced User Experience Are you looking for a way to improve the user experience of your website or application? Do you want to understand how users interact with your content and where their attention is focused? Look no further than GazeRecorder, the innovative eye tracking software that can help you gain valuable insights into human eye movement habits on the screen. GazeRecorder is a powerful utility software that tracks your eye movements and gaze on the computer screen. It employs complex tracking algorithms to track eyes and even works when your face is partially obstructed. With this software, you can calibrate your eye movements and face so it can learn where the eye moves on the screen. This means that you do not need any specialized hardware for using this. All you need is a PC and a webcam. This application creates a heat map of your gaze on the screen by recording aggregated gaze over your screen. Apart from recording a heatmap, this free eye tracking software also records calibration info and whole sample of eye movement in text files. You can also check out less sophisticated camera mouse here. One use case I can think of is to see if your website layout is user friendly. Just open up your website and let a user look over it while using GazeRecorder's tracking capabilities. This software will track the gaze of the user, allowing you to instantly know which areas of your website are getting most attention from users. The heat map generated by GazeRecorder provides an intuitive visual representation of where users are looking at any given time during their interaction with digital content such as websites or applications. By analyzing these heat maps, developers can identify areas that require improvement or optimization in order to enhance overall usability. In addition to its usefulness in web design, GazeRecorder has many other potential applications across various industries such as market research, advertising, gaming industry etc.. For example: In market research studies it could be used for testing product packaging designs; In advertising campaigns it could be used for measuring ad effectiveness; In gaming industry it could be used for enhancing game play experience etc.. As an added bonus feature,Gazerecorder offers demo mode which allows recording only 60 seconds but enough time period required for normal study purposes. Overall,Gazerecorder offers an easy-to-use solution with powerful features that make it ideal tool for anyone who wants better understanding about how people interact with digital content.Give Gazerecorder try today!
2016-09-26smartDesk
1.6.0If you're looking for a quick and easy way to access your virtual desktop environment, then smartDesk Client is the perfect solution. This software is designed to provide you with seamless access to your smartDesk virtual desktop environment, allowing you to work from anywhere at any time. SmartDesk Client is part of the Utilities & Operating Systems category of software, which means it's designed to help you manage and optimize your computer system. With this software, you can easily connect to your virtual desktop environment using just three pieces of information: your Virtual Machine Identifier (VMID), username, and password. One of the key benefits of using smartDesk Client is that it provides a secure connection between your computer and the virtual desktop environment. This means that all data transmitted between these two systems is encrypted, ensuring that no one can intercept or steal sensitive information. Another benefit of using smartDesk Client is that it's incredibly easy to use. Once you've entered in your VMID, username, and password, all you need to do is click "Connect" and wait for the connection process to complete. Once connected, you'll be able to access all of the applications and files stored on your virtual desktop environment as if they were installed directly on your local machine. In addition to providing secure remote access capabilities, smartDesk Client also offers a number of other features designed specifically for users who need quick and easy access their virtual desktop environments: - Multi-monitor support: If you have multiple monitors connected to your local machine or laptop, then smartDesk Client will automatically detect them when connecting. This allows you to use multiple screens when working in a remote session. - Clipboard sharing: SmartDesk Client allows users copy/paste text between their local machine/laptop clipboard and their remote session clipboard. - File transfer capabilities: You can easily transfer files between local machine/laptop storage devices (e.g., hard drives)and remote sessions by simply dragging-and-dropping files from one location into another. - Audio redirection: Smartdesk client supports audio redirection so users can listen music or watch videos from within their remote sessions without having sound quality issues Overall, smartdesk client provides an excellent solution for anyone who needs quick, secure,and reliable access to their virtual desktop environments. Whether working remotely or traveling frequently, this software makes it easy for users stay productive while away from home base.
2015-07-14Wise Plugin Manager
1.27.55Wise Plugin Manager is a powerful and user-friendly freeware that helps you manage all the plugins, add-ons, and extensions on your computer. It is designed to make your browsing experience more efficient and stable by allowing you to take full control of all the plugins installed on your browsers. The interface of Wise Plugin Manager is very concise, with four tabs representing the four most-used browsers it supports: Google Chrome, Internet Explorer, Mozilla Firefox, and Opera. This means that users don't have to bother opening the 'Settings' of each browser to operate them; they can do all the operations related to plugins, add-ons, and extensions with Wise Plugin Manager. One of the best things about Wise Plugin Manager is its ease of use. The software has been designed keeping in mind even those who are not tech-savvy. You don't need any technical knowledge or expertise to use this software effectively. Wise Plugin Manager allows users to set any of the four supported browsers as their default browser with just a few clicks. This feature comes in handy when you want a particular browser to open automatically whenever you click on a link or launch an application. Another great feature of Wise Plugin Manager is its 'Rating' option. With this feature, users can rate and review any plugin or extension they have installed on their browsers like toolbars or read reviews from other users before installing them. This helps users make informed decisions about which plugins they should install or remove from their browsers. Wise Plugin Manager also ensures that your browsing experience remains safe by providing complete control over all installed plugins and add-ons. Users can easily enable/disable any plugin or extension as per their requirements without worrying about security issues. In addition to these features, Wise Plugin Manager also offers excellent performance optimization for your web browsing experience by removing unnecessary plugins that may slow down your system's performance significantly. Overall, if you're looking for an easy-to-use yet powerful tool for managing all your browser's plugins efficiently while ensuring maximum security at every step – look no further than Wise Plugin Manager!
2015-05-07Krug Modbus OPC Server
2.3Krug Modbus OPC Server is a powerful utility software that provides OPC clients with access to devices supporting the MODBUS protocol. This software falls under the category of Utilities & Operating Systems and is designed to enhance the functionality of advanced SCADA systems, such as SCADA KRUG-2000. The Krug Modbus OPC Server supports various protocols, including MODBUS RTU, MODBUS TCP, and MODBUS ASCII. It also supports several MODBUS functions such as 1,2,3,4,5,6,15 and 16. The software can communicate through different channels like COM port and TCP connection. Additionally, it offers an opportunity to use an extended list of communication channel types (CSD,GPRS etc.) using the Modem Communication Channel Module special software. One of the key features of Krug Modbus OPC Server is its ability to poll tag groups at varying intervals. This feature increases the speed of reading critical parameters by reducing the frequency of reading less important or rarely changing parameters. The software interacts with OPC clients in accordance with the OPC DA specifications version 2.05a. It also has a service operation function for Windows OS Service which ensures smooth operation without any interruptions. Krug Modbus OPC Server allows group setting of tags which makes it easier for users to manage multiple tags simultaneously. Configuration import/export in CSV format (with report file formatting) significantly accelerates configuring processes while automatic search for connected devices reduces time required for arranging hard-wired connections between devices and computers. Another notable feature is its ability to survey and view tag values without an OPC client connection which allows initial setup without application of additional software as well as diagnosing potential problems in automated system development by separating SCADA level errors from device survey errors. Tag value emulation provides opportunities for debugging projects in upper-level systems without physical access to metering instruments while emulating critical values for testing upset situations easily creates educational projects for different purposes. In summary,Krug Modbus OPC Server offers a wide range of features that make it an essential tool for advanced SCADA systems.The ability to support various protocols coupled with its efficient communication channels makes it easy-to-use while providing accurate results.Its user-friendly interface ensures seamless integration into existing systems making it ideal even for beginners.With Krug ModbusOPC server,you can be sure that your system will operate smoothly without any interruptions or delays ensuring maximum efficiency at all times!
2016-09-30ClickerBot
1.0ClickerBot is a powerful and user-friendly automatic clicker robot that can help you automate repetitive tasks on your computer. Whether you need to click a button repeatedly, fill out forms, or perform other actions, ClickerBot can do it all for you with just a few clicks. One of the most advanced automatic clickers on the market today, ClickerBot is designed to be easy to use even for beginners. With its intuitive interface and customizable settings, you can set up your automation tasks in no time and start saving time and effort right away. But what sets ClickerBot apart from other automatic clickers is its versatility. Unlike some other tools that only imitate mouse movements and clicks, ClickerBot can also simulate keyboard events such as typing text or pressing keys. This makes it ideal for automating more complex tasks that require both mouse and keyboard input. Whether you're a gamer looking to automate repetitive actions in your favorite game or a professional who needs to streamline their workflow, ClickerBot has something for everyone. Here are just some of the features that make this software stand out: Easy-to-use interface: With its simple drag-and-drop interface, setting up automation tasks with ClickerBot is quick and easy. You don't need any programming skills or technical knowledge – just select the actions you want to automate from the list of available options and configure them according to your needs. Customizable settings: To ensure maximum flexibility, ClickerBot allows you to customize various settings such as delay times between clicks/keystrokes, randomization options (to avoid detection by anti-cheat systems), hotkeys for starting/stopping automation tasks on-the-fly, etc. Advanced scripting capabilities: For more advanced users who want even greater control over their automation scripts, ClickerBot offers support for scripting languages such as Lua or Python. This allows you to create custom scripts that can perform virtually any action on your computer – from opening files/folders/websites to sending emails or interacting with web APIs. Multi-platform support: Whether you're using Windows or Mac OS X (or even Linux), ClickerBot has got you covered. The software works seamlessly across all major operating systems without requiring any additional setup steps. Affordable pricing: Despite its advanced features and capabilities, ClickerBot remains one of the most affordable automatic clickers on the market today. You can purchase a lifetime license for just $29 USD – which includes free updates/upgrades for life! In conclusion If you're tired of performing repetitive tasks manually on your computer – whether it's clicking buttons in games/apps/websites or filling out forms online – then give ClickerBot a try! With its powerful yet user-friendly features and affordable pricing model, this software is sure to save you time and effort while boosting your productivity at work/home/school/etc. So why wait? Download now!
2015-02-27Showmysoft
2.0.1Showmysoft is a powerful software tool that falls under the category of Utilities & Operating Systems. It is designed to display all installed software with versions on local and remote machines, making it an essential tool for system administrators and IT professionals. With Showmysoft, you can easily export your software list to PDF or CSV format, allowing you to keep track of all your installed applications in a convenient and organized manner. Additionally, this software will also show you important system information such as model number, manufacturer details, serial number, processor info and system type. One of the most impressive features of Showmysoft is its ability to scan remote machines for installed software. This feature comes with two options: WMI (Windows Management Instrumentation) and Remote Registry. In order to use WMI scanning on a remote machine, administrative username and password are required. On the other hand, if using Remote Registry scanning option then 'Remote registry service' must be running on the remote machine along with sufficient permission. The application comes equipped with detailed help documentation that makes it easy for users to navigate through its various features without any difficulty. Moreover, there's no need to install this application as it's completely freeware and ad-free. Overall Showmysoft is an excellent utility tool that provides users with valuable insights into their systems' installed applications while also offering advanced features like remote scanning capabilities. Whether you're an IT professional or just someone who wants better control over their computer's applications list - Showmysoft has got you covered!
2015-01-04Serious Audio Control
1.0.1.14Serious Audio Control is a powerful audio volume controller designed for Midi Devices. It offers advanced features that allow users to map the main volume or per application volume to different controllers on a Midi Device, providing accurate and precise control over audio levels. With Serious Audio Control, you no longer need to worry about cluttered desktops filled with expensive audio/video controllers. You can easily adjust the volume of your music player or browser by simply moving a slider, without affecting the volume of other applications such as video chats with your parents or boss. One of the key features of Serious Audio Control is its ability to assign up to 10 controllers aside from the main controller. Each controller can have multiple applications assigned to it, allowing you to control all your browsers with just one slider. This feature makes it easy for users who work on multiple projects simultaneously and require different audio settings for each project. Another great feature of Serious Audio Control is its support for up to three Midi Devices working simultaneously. This means that you can connect multiple devices and control them all at once using this software. Serious Audio Control also offers customizable settings that allow users to adjust various parameters such as sensitivity, range, and response time according to their preferences. The software also supports hotkeys which make it easy for users who prefer keyboard shortcuts over mouse clicks. The user interface of Serious Audio Control is intuitive and user-friendly making it easy even for beginners who are not familiar with Midi Devices or advanced audio controls. The software comes with detailed documentation that explains how each feature works in detail making it easier for users who want more information about specific functions. In conclusion, if you're looking for an advanced audio volume controller that provides accurate and precise control over your sound system then look no further than Serious Audio Control! With its powerful features like mapping windows main volume or per application volume through sliders or rotary controllers along with customizable settings options like sensitivity range response time hotkeys support etc., this software will help take your music production game up several notches!
2014-12-25Keyboard Helper
2.0Keyboard Helper is a powerful software that falls under the category of Utilities & Operating Systems. It is designed to simplify the game keys and make keyboard operations easier for users. The software runs on all Windows platforms, making it accessible to a wide range of users. If you are an avid gamer or someone who spends a lot of time typing, you know how important it is to have a reliable keyboard that can keep up with your pace. Keyboard Helper is here to help you achieve just that! With its advanced features and capabilities, this software can take your keyboard experience to the next level. One of the most significant advantages of Keyboard Helper is its ability to simplify keyboard operations. Whether you are playing games or typing documents, this software can help you operate your keyboard more efficiently. It achieves this by allowing one key to represent two keys, which means that instead of pressing two keys simultaneously, you only need one keypress. For instance, if you want to press B-S simultaneously in a game or document editor, all you need is press B once while holding down the corresponding target key sequence (in this case S). This feature makes it easier for gamers and typists alike as they no longer have to struggle with complex combinations. Another great feature offered by Keyboard Helper is its ability to move right keys towards left ones. This means that if there are certain keys on your keyboard that are hard for you reach out due their position on the board layout; then with Keyboard Helper's assistance those hard-to-reach buttons will be moved closer towards where your fingers naturally rest when typing or gaming. Moreover, unwanted keys can be shielded using Keyboard Helper's advanced settings options so they don't interfere with other commands during gameplay or work sessions - giving users greater control over their keyboards than ever before! With these features combined into one powerful package - simplified operation modes; moving right buttons closer towards left ones; shielding unwanted keystrokes - there's no doubt about it: using Keyboard Helper will make any user very happy indeed! In conclusion, if you're looking for an easy-to-use yet powerful tool designed specifically for simplifying game controls and improving overall productivity when working at your computer then look no further than Keyboard Helper! Its intuitive interface coupled with advanced features makes it an ideal choice for anyone who wants better control over their keyboards without having too much technical knowledge about computers themselves!
2016-12-09Word2PowerPoint
1.0Word2PowerPoint is a powerful software tool that simplifies the process of creating presentation slides from lengthy reports. This utility is designed to help users save time and effort by automating the process of converting written content into visually appealing slides. With just a single click, Word2PowerPoint can generate professional-looking presentations that are sure to impress your audience. Whether you're a student, business professional, or anyone else who needs to create presentations on a regular basis, this software can help you streamline your workflow and get more done in less time. One of the key benefits of using Word2PowerPoint is its ability to handle large documents with ease. If you've ever tried to manually create presentation slides from a lengthy report or document, you know how time-consuming and tedious this task can be. With Word2PowerPoint, however, you can quickly and easily convert even the longest documents into polished presentations that are ready for delivery. Another advantage of using Word2PowerPoint is its accuracy. While Microsoft's built-in outline feature can be helpful for creating basic slide decks, it often falls short when it comes to more complex documents with multiple sections and subsections. With Word2PowerPoint's advanced algorithms and intelligent formatting options, however, you can rest assured that your presentation will be accurate and well-organized every time. In addition to its core functionality as a document-to-presentation converter tool, Word2PowerPoint also includes several other useful features that make it an indispensable part of any presenter's toolkit. For example: - Agenda generation: With just one click, Word2PowerPoint can automatically generate an agenda slide at the beginning of each section or subsection in your document. - Customizable templates: Choose from a variety of pre-designed templates or create your own custom template for consistent branding across all your presentations. - Image insertion: Easily add images or graphics directly into your presentation slides without having to switch back-and-forth between applications. - Slide editing: Fine-tune individual slides as needed with easy-to-use editing tools like text formatting options and image cropping. Overall, if you're looking for an efficient way to turn long reports into engaging presentations without sacrificing accuracy or quality in the process - look no further than Word2Powerpoint! This powerful utility offers everything you need to streamline your workflow while producing top-notch results every time.
2015-01-18Insomniate
1.0.0.1Insomniate: Keep Your Computer Awake and Productive Are you tired of your computer going into Sleep/Standby mode when you need it to stay awake? Do you find yourself constantly adjusting your power settings just to keep your computer from shutting down? If so, Insomniate is the solution for you. Insomniate is a lightweight app that prevents your computer from going into Sleep/Standby mode. This is especially useful when you don't have access to change your computer's power settings, such as in a work environment or on a public computer. With Insomniate, you can keep your computer awake and productive for as long as you need it. One of the best things about Insomniate is its simplicity. It's a portable single executable which means installation is not required. You can simply download the app and run it whenever you need it. And if you no longer need it, just delete the downloaded file – there's no complicated uninstall process. Insomniate comes in two versions: Insomniate Simple and Insomniate (non-simple). Both versions are lightweight apps that run in the background (System Tray area), but they differ in their user interface. With Insomniate Simple, there is no GUI – just launch the app and forget about it. As long as the app is running (in the System Tray area), your computer will not go into Sleep/Standby mode. This version of Insomniate is perfect for those who want a hassle-free experience without any additional settings to adjust. On the other hand, with Insomniate (non-simple), there is a GUI where users can manipulate its built-in countdown timer and change how often they want it to interact with their computers to keep them awake. This version of Insomniaite offers more customization options for those who prefer more control over their software. Regardless of which version of Insomniaite users choose, they can rest assured that their computers will stay awake when they need them most. Whether working on an important project or watching a movie late at night, users can rely on this software to prevent any unwanted interruptions caused by sleep mode. In addition to its primary function of keeping computers awake, another benefit of using this software is its low resource usage – meaning that even while running in the background continuously, users won't notice any significant impact on their system performance or battery life. Overall, if keeping your computer awake and productive matters to you then look no further than insominatite! Its simple yet effective design makes sure that all types of users are able get what they want out from this utility tool without having too much trouble setting up anything complex!
2015-08-03Monitoring COM Port
1.0.0.3Monitoring COM Port is a powerful software program designed to receive and send data through com ports. This utility software falls under the category of Utilities & Operating Systems, and it is an essential tool for anyone who needs to monitor data transmission through com ports. With Monitoring COM Port, you can easily analyze data for carriage return and tab. The program allows you to ignore user-defined data or split data with user-defined characters. Data are split into user-defined columns and stored in an organized manner. One of the most impressive features of Monitoring COM Port is its ability to automatically store or export data in Excel format. Each new set of received data is stored in Excel format on the clipboard, making it easy for you to access your information at any time. The setup process for Monitoring COM Port is simple and customizable. You can choose your preferred background color and font style for the main form, making it easier on your eyes during long periods of use. Another great feature of this software program is its ability to send repeatedly at user-defined intervals. If you need continuous monitoring every second, you can set up an interval that writes the received data into a database every 60 seconds. Overall, Monitoring COM Port offers a comprehensive solution for anyone who needs to monitor com port transmissions effectively. Whether you're working with industrial equipment or simply need a reliable way to track serial communication between devices, this software has everything you need to get started quickly and efficiently. Key Features: - Receive/send through com ports - Analyze data for carriage return/tab - Ignore/split user-defined data - Split into columns & store - Automatic storage/export in Excel format - Customizable main form (background color/font) - Send repeatedly at user-defined intervals
2015-11-08Virtual Camera
3.0Virtual Camera is a lightweight and user-friendly screen capturing software that allows you to take snapshots of your entire screen or a specific area with just one click. This software solution falls under the category of Utilities & Operating Systems, and it is designed to provide users with a fast and comfortable method of taking screenshots. With an abundance of similar applications available in the market, Virtual Camera stands out from the crowd through its ease of use and portability. Its interface is intuitive, consisting of a transparent window that can be adjusted in size and moved around the desktop as per your convenience. The simplicity of this application makes it easy for users to operate regardless of their experience level. Taking a new snapshot using Virtual Camera is just a matter of pressing a button. You can capture the entire screen or select an area on your desktop that you want to capture. Screenshots can be saved in BMP, PNG, JPG or GIF format to any user-defined location on your local hard drive. One unique feature that sets Virtual Camera apart from other similar applications is its ability to preview screenshots within the main window prior to saving them. This feature ensures that you have captured exactly what you intended before saving it on your computer. Virtual Camera also offers customization options such as adjusting interface opacity levels and setting up automatic startup with Windows along with defining startup window size and position on-screen. Additionally, there's also an option for 'compact mode' which makes GUI really small comprising only capturing buttons. This software solution focuses primarily on speed and simplicity rather than complicated configuration options making it ideal for users who don't require advanced screen capturing capabilities but want basic functionality like pressing one button for taking snapshots quickly without any hassle. In conclusion, if you're looking for an easy-to-use yet powerful screen capturing tool then Virtual Camera should definitely be at the top of your list! With its simple interface design coupled with customizable features like opacity levels adjustment & automatic startup settings make this utility stand out among others in its category providing great value at affordable pricing!
2015-02-25XCross Drag
5.3XCross Drag: The Ultimate Solution for Gmail Contact Management Are you tired of manually copying and pasting your Gmail contacts between two address books? Do you wish there was an easier way to manage your contacts without the hassle of exporting and importing files? Look no further than XCross Drag, the ultimate solution for Gmail contact management. XCross Drag is a powerful utility software that enables you to copy your Gmail contacts between two address books with ease. With just a few clicks, you can open two Gmail address books at once and drag & drop contacts from one book to another. Plus, photos are also copied together, making it easy to keep track of all your important information. Whether you're managing multiple email accounts or simply need a more efficient way to organize your contacts, XCross Drag is the perfect tool for the job. And best of all, it's available for Google Apps users as well. Key Features: - Copy Contacts Between Two Address Books: With XCross Drag, you can easily copy your Gmail contacts between two address books with just a few clicks. No more manual copying and pasting required! - Open Two Address Books at Once: XCross Drag allows you to open two Gmail address books at once so that you can easily drag & drop contacts from one book to another. - Copy Photos Together: In addition to contact information, XCross Drag also copies photos together so that all your important information stays organized in one place. - Available for Google Apps Users: Whether you're using regular Gmail or Google Apps, XCross Drag is available for both platforms so that everyone can benefit from its powerful features. Why Choose XCross Drag? There are plenty of contact management tools out there on the market today. So why should you choose XCross Drag over other options? Here are just a few reasons: 1) Easy-to-use Interface: The user interface of XCross Drag is designed with simplicity in mind. You don't need any technical knowledge or experience in order to use this software effectively. 2) Saves Time & Effort: By automating the process of copying and pasting contact information between two address books, XCross Drag saves time and effort compared with manual methods. 3) Works Seamlessly with Google Services: Since it's specifically designed for use with Google services like Gmail and Google Apps, users can rest assured that they'll be able to integrate this software seamlessly into their existing workflows without any issues or complications. 4) Affordable Pricing Model: Compared with other similar tools on the market today which may charge exorbitant fees or require expensive subscriptions in order to access their full range of features; pricing model makes it accessible even if someone has limited budget How Does It Work? Using Xcross drag couldn't be simpler! Here's how it works: 1) Download & Install Software - First step is downloading xcross drag from our website then install it on computer 2) Login To Your Account - After installation login into gmail account where we want transfer our data 3) Open Two Address Books - Once logged in click on "Open" button which will allow us opening 2 gmail accounts simultaneously 4) Select Contacts To Transfer - Now select those specific emails which we want transfer by clicking them 5) Start Transfer Process - Finally click "Transfer" button after selecting emails then wait until process completes successfully Conclusion: In conclusion,Xcross drag provides an easy-to-use solution for anyone who needs help managing their gmail account’s contact list.Its simple interface makes transferring data quick while saving time compared against manual methods.The affordable pricing model ensures accessibility even if someone has limited budget.So why not give xcross drag try today?
2015-07-30Daossoft Product Key Rescuer
3.0.0.1Daossoft Product Key Rescuer is a powerful product key recovery tool that helps you recover product keys or serial numbers of various software applications. This utility software works with all Windows computers, even if the hard disk is crashed. With just one click, you can find product keys on your Windows PC. This software is designed to help users who have lost their product keys or need to reinstall their operating system or other software applications. It supports a wide range of products including Windows, Office, Visual Studio, SQL Server, Exchange Server, VMware and Adobe. Key Features: 1. Find Product Keys for Various Versions of Windows: Daossoft Product Key Rescuer can find product keys for various versions of Windows including 8, 7, Vista, XP and more. 2. Find Product Keys for Microsoft Office: This tool can also retrieve the product key for Microsoft Office 2010/2007/2003/XP/2000. 3. Recover Product Keys for SQL Server: Daossoft Product Key Rescuer can recover the product key for SQL Server 2000/2005/2008. 4. Retrieve Product Keys for Microsoft Exchange Server: The software also retrieves the product key for Microsoft Exchange Server 2000/2003/2007/2010. 5. Find Product Keys of Other Software Applications: In addition to finding the above-mentioned products' keys; it also finds the license codes of Internet Explorer, Adobe Acrobat Reader DC Pro XI X etc., VMware Workstation Player Pro and Visual Studio Professional Editions 6. Recover from External Hard Disk Drive: If you have an external hard disk drive connected to your computer that contains important data but has crashed; this tool will help you recover its license code as well as other installed programs' codes too! 7. Recover from Crashed Hard Disk Drive or Unbootable Computer: If your computer's hard disk drive has crashed or it won't boot up properly; this utility will still be able to retrieve its license code(s). 8.User-Friendly Interface - The interface is easy-to-use and intuitive so that even novice users can use it without any difficulty. 9.Backup & Save Your Recovered License Codes - You can backup and save all recovered license codes in a secure location so that they are not lost again in case something goes wrong with your computer system later on! 10.Free Technical Support - Daossoft offers free technical support via email if you encounter any issues while using this program. Conclusion: Daossoft Product Key Rescuer is an essential utility tool that every user should have in their toolkit! It helps users recover lost or forgotten license codes quickly and easily without having to go through complicated procedures manually! With its user-friendly interface and advanced features like recovering from external drives/crashed disks/unbootable computers; there's no reason not to give it a try today!
2015-04-21Windows Sound Changer
1.2.19.1Windows Sound Changer: Change Your Windows Operating System Sounds with Ease Are you tired of hearing the same old sounds every time your Windows Operating System performs an action? Do you want to customize your computer's sound effects to better suit your preferences? If so, then Windows Sound Changer is the perfect solution for you. Windows Sound Changer is a free program designed specifically for changing the sound effects of various events on your Windows Operating System. With this software, you can easily change the sounds that play when you receive a new email, log in or out of your computer, or even when an error occurs. One of the best features of Windows Sound Changer is its ability to use custom sounds. This means that if you have a specific sound effect in mind that you would like to use instead of the default one, all you need to do is select it from your computer's files and apply it within the program. This feature allows for endless possibilities when it comes to personalizing your computer's audio experience. In addition to custom sounds, Windows Sound Changer also includes a Robotic Sound Pack. This pack contains various robotic voices and sound effects that can be applied to all or specified events on your operating system. With this feature enabled, every time an event occurs on your computer, it will speak like a robot - adding some fun and personality into an otherwise mundane task. Another useful function included in Windows Sound Changer is its play function. This allows users to hear what their selected sound effect will sound like before applying it permanently. By doing so, users can ensure they are happy with their selection before committing any changes. Overall, Windows Sound Changer provides users with an easy-to-use interface and endless customization options for their operating system's audio experience. Whether looking for something simple or wanting more advanced features such as robotic voices - this software has something for everyone. Key Features: - Customizable Sounds: Use any audio file as a replacement for default system sounds. - Robotic Voice Pack: Add some personality by enabling robotic voiceovers. - Play Function: Preview selected audio files before applying them permanently. - Easy-to-use Interface: Simple design makes customization easy even for beginners. - Free Software: No cost involved in downloading or using this software. How Does It Work? Using Windows Sound Changer couldn't be easier! Simply download and install the program onto your computer (compatible with most versions of Microsoft windows). Once installed open up the application whereupon there are two tabs available; "Custom Sounds" & "Robotic Voice Pack". The first tab "Custom Sounds" allows users access to all current system event sounds which can be changed by selecting each individual event from within this tab (e.g., New Mail Notification). Once selected click browse button next each event which opens up file explorer allowing user select desired. wav file from local storage device (e.g., desktop) then click save button at bottom right corner screen after selecting desired. wav file(s). The second tab "Robotic Voice Pack" enables user add robotic voiceovers across entire operating system by simply clicking enable button located top left corner screen under heading 'Enable Robotic Voices'. Users also have option choose specific events they wish apply these voiceovers too via drop down menu located below enable button. Why Choose Window Sounds changer? There are many reasons why someone might choose Window Sounds changer over other similar programs available online today: 1) Customization Options - With Window Sounds changer there are endless possibilities when it comes personalizing operating systems' audio experience thanks customizable options such as custom sounds & robotic voice packs! 2) User-Friendly Interface - The simple design makes customization easy even beginners who may not have much technical knowledge about computers! 3) Free Software - There no cost involved downloading using this software meaning anyone can enjoy benefits without having spend money upfront! Conclusion In conclusion if looking add some personality into otherwise mundane tasks performed daily basis then look no further than Window Sounds changer! With its customizable options including custom sounds & robotic voice packs along user-friendly interface make personalizing operating systems' audio experience breeze! Plus being free download use means anyone can enjoy benefits without having spend money upfront!
2015-01-22Pixel Change Detector
3.0Pixel Change Detector is a powerful and versatile tool that falls under the category of Utilities & Operating Systems. This software is designed to identify color changes on a selected pixel and alert the user with an audio and visual notification. It is an incredibly useful tool for various applications, such as screen monitoring or progress bar alerts. The Pixel Change Detector software has been developed to cater to the needs of users who require real-time monitoring of their screens. The software can be used for a wide range of purposes, including website testing, video editing, game development, and more. With its advanced features and intuitive interface, this software makes it easy for users to monitor their screens with ease. One of the most significant advantages of using Pixel Change Detector is its ability to detect even minor changes in color on a selected pixel. This feature makes it ideal for use in situations where accuracy is critical. For instance, if you are working on a project that requires precise color matching or need to monitor your screen for any changes during video playback or gaming sessions. Another great feature of Pixel Change Detector is its ability to provide both audio and visual notifications when it detects any change in color on the selected pixel. This feature ensures that you never miss any important updates or changes while working on your projects. The software also comes with several customization options that allow users to tailor it according to their specific needs. Users can adjust settings such as sensitivity levels, notification sounds, colors displayed during detection alerts among others. Pixel Change Detector has been designed keeping user convenience in mind; hence it's straightforward-to-use interface allows even novice users without prior experience with similar tools can easily navigate through its features without much hassle. Furthermore, this powerful utility tool comes free-of-charge! Yes! You read that right; Pixel Change Detector offers all these amazing features at no cost whatsoever! In conclusion: If you're looking for an efficient way to monitor your screen accurately while working on projects such as website testing or video editing - look no further than Pixel Change Detector! Its advanced features coupled with its intuitive interface make it one of the best utilities available today! And did we mention? It's completely free!
2014-12-19CTsoft
1.16.0.3CTsoft is a powerful software tool designed for configuring and optimizing a wide range of drives, including Digitax ST Base, Digitax ST Indexer, Digitax ST Plus, Digitax ST EZMotion, FXMP25 Field Controller, Mentor MP, Unidrive 'Classic' in open-loop, closed-loop vector and servo modes, Unidrive SP open-loop, closed-loop vector servo modes and regen mode Commander SK drives Commander GP20 Drive in open-loop and closed-loop vector mode as well as Unidrive ES open-loop closed loop vector and servo modes. This versatile software is an essential tool for anyone who needs to configure or optimize their drive systems. With CTsoft's intuitive interface and user-friendly design features such as drag-and-drop functionality make it easy to use even for those with little experience. The software provides users with the ability to configure parameters such as motor control settings (including speed control), input/output settings (such as digital inputs/outputs), communication protocols (such as Modbus RTU/TCP) among others. One of the key benefits of CTsoft is its ability to provide real-time monitoring of drive performance. This feature allows users to quickly identify any issues that may arise during operation. Additionally CTsoft can be used for troubleshooting purposes by providing detailed diagnostic information about the system's performance. Another important feature of CTsoft is its ability to save configuration files which can be easily transferred between different drives or systems. This makes it easy for users to replicate successful configurations across multiple machines or applications without having to manually reconfigure each one individually. CTsoft also offers advanced features such as graphical programming tools that allow users to create custom programs using a simple drag-and-drop interface. These programs can then be uploaded directly into the drive system allowing for greater flexibility in automation processes. In addition to its powerful configuration capabilities CTsoft also provides comprehensive documentation on all supported drives including detailed technical specifications and wiring diagrams making it easier than ever before for engineers or technicians working on these systems. Overall CTSoft is an essential tool that should be part of every engineer's toolkit when working with complex drive systems. Its intuitive interface combined with advanced features make it easy-to-use while still providing all the necessary functionality required by professionals in this field. Whether you are configuring new equipment or troubleshooting existing ones this software will help you get your job done faster more efficiently than ever before!
2016-08-25AllPlayer Remote Control
1.3AllPlayer Remote Control is a powerful utility software that allows you to control any player using your Android smartphone in Wi-Fi or Internet mode connection. With this software, you can easily control the mouse cursor as easily as on your laptop. The virtual touchpad and using the left and right mouse button gives you unlimited access to all programs installed on your computer. One of the best things about AllPlayer Remote Control is that it does not require any additional settings in most cases because it detects PC's IP, ALLPlayer has been installed on. However, in case of connection problems, you can check IP address and port of your PC in the ALLPlayer Remote Assistant [setup] installed on your PC and enter the data manually in the ALLPlayer Remote on your Android device. The touchpad works smoothly on Wi-Fi mode but due to large delay Internet mode is not advisable. You can use your favorite Android keyboard for typing (for example Swype or Slide keyboard installed from Google Play). With this application, you are able to transfer files between your PC and Android device (tablet or smartphone). It's very simple - display ALLPlayer Remote Assistant window on your PC and drag files to it - they will be automatically sent to your Android device. Connection monitoring shows downloaded (red) and uploaded (green) data, and the speed of Internet connection. With this option, you can monitor whether any programs do not send data without your knowledge, and whether the download is done at the speed declared by Internet provider. It shows the amount of data uploaded and downloaded in a given day and in current month. AllPlayer Remote Control offers an easy-to-use interface with intuitive controls that make it easy for anyone to use regardless of their technical expertise level. Whether you're looking for a way to control media players remotely or simply want an easier way to transfer files between devices without having to deal with cables or complicated setup processes – AllPlayer Remote Control has got everything covered! In conclusion, if you're looking for a reliable remote control solution that offers advanced features such as file transfer capabilities along with intuitive controls – then look no further than AllPlayer Remote Control!
2016-04-22XSPro to Cross Stitch Saga (Russian)
1.0XSPro to Cross Stitch Saga (Russian) - The Ultimate Tool for Pattern Protection Are you a designer who creates beautiful cross-stitch patterns using XSPro application? Do you worry about pattern piracy and unauthorized use of your designs? If yes, then XSPro to Cross Stitch Saga is the perfect tool for you. This specialized utility creates an encrypted. CSS file from your. XSP pattern, which can only be opened in the Cross Stitch Saga mobile app. This ensures that your patterns are protected and cannot be edited or copied by anyone else. XSPro to Cross Stitch Saga is a powerful software tool that offers complete protection for your cross-stitch patterns. It is designed specifically for designers who use XSPro application and want to protect their intellectual property from piracy and unauthorized use. With this tool, you can easily encrypt your patterns and share them with clients without worrying about their security. How it Works Using XSPro to Cross Stitch Saga is easy and straightforward. Simply open the application on your PC, choose the. XSP pattern that you want to protect, and it will be encrypted and saved as a. CSS file. The resulting. CSS pattern can then be sent to your client for embroidery using the Cross Stitch Saga mobile app. The encryption process used by XSPro to Cross Stitch Saga is highly secure, ensuring that no one else can access or modify your patterns without authorization. The encrypted files are also compact in size, making them easy to share via email or other digital channels. Benefits of Using XSPro to Cross Stitch Saga There are several benefits of using XSPro to Cross Stitch Saga: 1) Complete Pattern Protection: With this tool, you can ensure complete protection of your cross-stitch patterns from piracy and unauthorized use. 2) Easy Sharing: You can easily share encrypted. CSS files with clients via email or other digital channels. 3) Secure Encryption: The encryption process used by this tool is highly secure, ensuring that no one else can access or modify your patterns without authorization. 4) Compact File Size: Encrypted files created by this tool are compact in size, making them easy to store and share. 5) Compatibility: Encrypted files created by this tool are compatible only with the Cross Stitch Saga mobile app, ensuring complete control over how they are used. Conclusion If you're a designer who uses XSPro application for creating cross-stitch patterns, then protecting them from piracy should be a top priority. With XSPro to Cross Stitch Saga (Russian), you have an easy-to-use yet powerful software tool at hand that ensures complete protection of all your designs. So why wait? Download it today!
2016-08-26iNaVB Folder Protector
1.02iNaVB Folder Protector is a powerful software that provides limited protection for folders on the Windows operating system. This software is designed to protect sensitive data that may be too important or confidential to be accessed by others, especially children. With iNaVB Folder Protector, you can easily secure your important work documents, confidential files, and even movies that are not suitable for children. The purpose of this software is to provide early protection for your folders and documents. Although the protection provided by iNaVB Folder Protector is not very deep, it serves as an effective way to keep your data safe from unauthorized access. You can also use other means to protect your important folders and documents if you need more advanced security measures. One of the suggested uses of iNaVB Folder Protector is for protecting large amounts of data in a single folder. If you have more than 4 GB of data in one folder, this software can help you keep it safe from prying eyes. However, even if you have smaller amounts of data that need protection, iNaVB Folder Protector can still be an effective tool. This software is particularly useful for parents who want to ensure their children do not access files that are inappropriate or harmful. By using iNaVB Folder Protector, parents can rest assured knowing their children are protected from potentially harmful content on their computers. Overall, iNaVB Folder Protector provides a simple yet effective solution for protecting sensitive data on Windows operating systems. Whether you're looking to safeguard work documents or keep your kids safe online, this software offers an easy-to-use solution with reliable results. Key Features: - Provides limited but effective early protection - Suitable for protecting large amounts of data in one folder - Easy-to-use interface - Ideal for parents who want to protect their children from inappropriate content Benefits: 1) Early Protection: With its limited but effective early protection capabilities,iNaVBFolderProtector helps prevent unauthorized access before it's too late. 2) Large Data Protection: This software allows users with large amounts of sensitive information stored in one folder (over 4GB)to easily secure them. 3) User-Friendly Interface: The user-friendly interface makes it easy evenfor novice users. 4) Child Safety: Parents concerned about what their kids might stumble upon while browsing the internet will find peace-of-mind knowing they've taken steps towards keeping them safe. How It Works: iNavBFolderProtector works by encrypting selected folders so they cannot be opened without entering a password.Users simply select which folders they wish to encrypt,and then set up a password.Once encrypted,the selectedfolders will remain locked until the correct password has been entered.This process ensures only authorized users have access. Conclusion: In conclusion,iNavBFolderProtectoris an excellent choicefor anyone lookingto addan extra layerof securitytotheir computerfiles.The program's ease-of-useand effectiveness makeit idealfor both noviceand experiencedusers alike.Whetherprotectinglargeamountsofdataorkeepingchildrensafe,thissoftwareoffersa simpleyetreliablewaytosecureyourimportantinformation.So why wait? DownloadiNavBFolderProtectortodayand startprotectingyourfiles!
2015-04-20Get Windows 10 Removal Tool
1.0Are you tired of constantly being prompted to upgrade to Windows 10? If so, the Get Windows 10 Removal Tool is the solution you've been looking for. This utility software is designed specifically for those who do not want to upgrade their operating system and want to remove the notification from their taskbar. The Get Windows 10 Removal Tool falls under the category of Utilities & Operating Systems. It is a lightweight software that can be easily downloaded and installed on your computer. Once installed, it will remove the Windows 10 notification from your taskbar, giving you peace of mind and uninterrupted work experience. This tool is incredibly easy to use. Simply save it onto your hard drive and click on it to launch it. Once launched, press the "Remove Get Windows 10 Icon" button, and voila! The notification will be removed from your taskbar. One of the best things about this tool is that it does not contain any adware/spyware or viruses. You can rest assured that your computer's security will not be compromised in any way by using this software. In addition to its ease of use and security features, there are several other benefits of using this tool: 1) Improved Performance: By removing unnecessary notifications from your taskbar, you'll free up valuable system resources which can improve overall performance. 2) Increased Productivity: With fewer distractions popping up on your screen, you'll be able to focus more on important tasks at hand without interruptions. 3) Customizable Settings: The Get Windows 10 Removal Tool allows users to customize settings according to their preferences. For example, users can choose whether they want notifications for other updates or not. 4) Compatibility: This tool works with all versions of Microsoft's operating systems including Windows XP/Vista/7/8/8.1/10 (32-bit & 64-bit). Overall, if you're someone who doesn't want constant reminders about upgrading their operating system or simply wants a cleaner desktop experience without unnecessary distractions - then look no further than the Get Windows 10 Removal Tool!
2015-12-21WinRoot
1.0WinRoot: Unlocking the Power of Session 0 If you're a Windows user, you're probably familiar with the concept of user sessions. Each time you log in to your computer, a new session is created that allows you to interact with the operating system and run applications. However, there's another type of session that most users never see: Session 0. Session 0 is a special system-level session that runs in the background and provides essential services for Windows. It's isolated from user sessions for security reasons, which means that applications running in Session 0 can't interact with users or display graphical interfaces. That's where WinRoot comes in. This powerful utility is designed to unlock features of Session 0 that are not available in interactive user sessions. With WinRoot, you can access high privileges normally reserved for system processes and bypass the isolation protection of Session 0. How does it work? WinRoot uses the account System (NT AUTHORITY\System) in Session 0 to obtain high privilege that the user normally does not pose. This means that even if your own account doesn't have administrative rights or other elevated permissions, WinRoot can give you access to them through System. One key advantage of using WinRoot is its ability to create interactive processes without requiring an Interactive Service Detection dialog. Normally, when an application tries to create an interactive process under Session 0, Windows will display a warning message asking for permission from the logged-in user before proceeding. This can be inconvenient or impossible if no one is currently logged on or if there are no active desktops available. With WinRoot, however, this limitation is removed because it creates an instance of explorer window under Session 0 which helps us browse through files and folders without any restrictions. Another benefit of using WinRoot is its ability to take ownership over files and folders owned by TrustedInstaller without modifying ownership itself - something which would otherwise require administrative privileges on top! Overall, Winroot offers a powerful set of tools for advanced users who need more control over their systems than what standard user accounts provide - especially when dealing with complex software installations or troubleshooting issues related specifically around privileged access levels within Windows environments. Key Features: - Unlock features only available within System-level Sessions - Bypass isolation protection within Sessions - Create Interactive Processes without requiring Interactive Service Detection Dialog - Access High Privileges normally reserved only for System Processes - Take Ownership over Files & Folders owned by TrustedInstaller Who Can Benefit From Using Winroot? Winroot was designed primarily as a toolset aimed at IT professionals who need more control over their systems than what standard user accounts provide - especially when dealing with complex software installations or troubleshooting issues related specifically around privileged access levels within Windows environments. However anyone looking into advanced customization options may find value here too! For example: Developers working on low-level code may find themselves needing direct access into certain parts of their operating system environment. Security researchers looking into vulnerabilities may also benefit from having greater visibility into how different parts work together. Power Users who want more granular control over their systems than what standard User Accounts offer could also find value here too! Conclusion: In conclusion we believe winroot offers some unique capabilities compared against other utilities out there today; particularly those focused solely on unlocking higher level permissions/access rights across different versions/editions/versions-of-Windows-environments etc.. Whether it’s developers working on low-level code; security researchers investigating vulnerabilities; power-users wanting granular controls beyond typical User Accounts – all these groups stand potentially benefitting greatly from utilizing this toolset!
2016-08-28Serial Port Terminal
1.5Serial Port Terminal: The Ultimate Tool for Serial Data Communication Serial Port Terminal is a powerful software tool designed to help you send and receive data over serial ports. Whether you are working with microcontrollers, sensors, or other electronic devices, this software can make your life much easier by providing a simple and intuitive interface for communicating with your hardware. With Serial Port Terminal, you can easily monitor the data being sent and received by your device in real-time. This allows you to quickly identify any issues or errors that may be occurring during communication. You can also use the software to troubleshoot problems with your hardware or test different configurations to optimize performance. One of the key benefits of using a serial terminal program like Serial Port Terminal is that it allows you to see exactly what is happening at the hardware level. This means that you can get a better understanding of how your device is functioning and make more informed decisions about how to optimize its performance. In addition to its monitoring capabilities, Serial Port Terminal also provides advanced features for configuring and controlling your device. You can use the software to calibrate sensors, configure modules, and perform other tasks that require direct access to the hardware. Overall, if you are working with microcontrollers or other electronic devices that rely on serial communication protocols, then Serial Port Terminal is an essential tool in your arsenal. With its powerful features and intuitive interface, this software makes it easy for anyone – from beginners to experienced professionals – to communicate effectively with their hardware. Key Features: Real-time monitoring: See data being sent and received by your device in real-time Troubleshooting/debugging: Quickly identify any issues or errors occurring during communication Communication testing: Test different configurations of your device for optimal performance Calibrating sensors: Use advanced features within the software for sensor calibration Configuring modules: Configure modules directly through our user-friendly interface Data monitoring: Monitor all incoming/outgoing data from connected devices Ease-of-use Interface: Simple yet powerful user-interface makes it easy-to-use even if one has no prior experience Compatibility: Compatible across multiple operating systems including Windows 10/8/7/Vista/XP (32-bit & 64-bit), Linux (Ubuntu) & Mac OS X Conclusion: Serial Port Terminal is an essential tool for anyone who works with microcontrollers or other electronic devices that rely on serial communication protocols. With its powerful features and intuitive interface, this software makes it easy for anyone – from beginners to experienced professionals –to communicate effectively with their hardware. Whether you are troubleshooting/debugging issues related communications between two devices; testing different configurations; calibrating sensors; configuring modules; monitoring incoming/outgoing data from connected devices - Serial port terminal has got everything covered! So why wait? Download now!
2015-10-23ClrMamePro (64-bit)
4.021aClrMamePro (64-bit) is a powerful utility that has been designed to cater to the needs of the emulation scene. It is an essential tool for anyone who wants to manage their ROM files effectively. The software checks all individual ROM files against a data file, ensuring that they have the correct information in them. ROM files are used by emulators to store games, and ClrMamePro (64-bit) ensures that these files are correctly organized and maintained. The software is compatible with nearly all arcade emulators and some console games too. The software's primary function is to ensure that your ROM collection remains up-to-date and error-free. It does this by comparing your existing ROMs with a database of known good dumps, which it downloads from various sources online. This process ensures that you have the most accurate version of each game in your collection. ClrMamePro (64-bit) also has several other features that make it an indispensable tool for any emulation enthusiast. For example, it can scan your entire collection for duplicates or missing files, allowing you to clean up your library quickly. Another useful feature of ClrMamePro (64-bit) is its ability to create custom data files for specific emulators or consoles. This feature allows you to tailor the software's functionality precisely according to your needs. The user interface of ClrMamePro (64-bit) is straightforward and easy-to-use, making it accessible even for beginners in emulation. The software provides detailed reports on any errors or inconsistencies found during scanning so you can fix them quickly. Overall, ClrMamePro (64-bit) is an excellent utility for anyone who wants to maintain their ROM collection accurately and efficiently. Its comprehensive features make it one of the best tools available in its category. Key Features: 1. Accurate Scanning: ClrMamePro (64-bit) scans each individual ROM file against a database of known good dumps ensuring accuracy. 2. Custom Data Files: Create custom data files tailored specifically towards certain emulators or consoles. 3. Duplicate Detection: Quickly identify duplicate or missing files within your library. 4.User-Friendly Interface: Easy-to-use interface makes managing large collections simple. 5.Detailed Reports: Receive detailed reports on any errors found during scanning. System Requirements: - Windows 7/8/10 - 1 GHz processor - 512 MB RAM - 50 MB free hard disk space Conclusion: In conclusion, if you're looking for a reliable utility tool designed explicitly for managing emulator-related tasks such as maintaining accurate collections while detecting duplicates or missing items within seconds - then look no further than ClrMamePro(64-Bit). With its user-friendly interface coupled with detailed reporting capabilities - this program will help keep everything organized without breaking a sweat!
2015-07-22EyePro
2.2EyePro is a powerful software that belongs to the Utilities & Operating Systems category. It is designed to protect your eyes from the harmful effects of blue light emitted by computer screens. With EyePro, you can enjoy playing games or watching movies at night without worrying about eye strain or fatigue. One of the key features of EyePro is its ability to open the eye-protection mode for your computer. This mode filters out blue light and reduces glare, making it easier on your eyes when using your computer for extended periods. Compared to other popular software like Night Shift and F.lux, EyePro is more specialized in filtering blue light and provides a more comfortable viewing experience. In addition to its eye-protection capabilities, EyePro also offers several other functions that aid in sleep improvement and tiredness reminder. These features make it an excellent tool for those who spend long hours working on their computers or watching videos late into the night. One of the most significant benefits of using EyePro is its ability to relieve symptoms associated with dry eyes and eye fatigue caused by prolonged screen time. By reducing exposure to blue light, this software helps prevent these symptoms from occurring in the first place. Overall, if you're looking for a reliable solution that can help protect your eyes while using your computer, then look no further than EyePro! With its advanced features and user-friendly interface, this software makes it easy to stay productive while keeping your eyes healthy at all times.
2016-07-01UUkeys Windows Password Mate
3.6.1UUkeys Windows Password Mate is a powerful software that belongs to the Utilities & Operating Systems category. It is designed to help users recover lost or forgotten passwords for their Windows PC in less than 10 minutes. This software is an essential tool for anyone who has ever been locked out of their computer due to a forgotten password. When you forget your login password, it can be frustrating and stressful, especially if you have important data on your computer that you need access to. With UUkeys Windows Password Mate, however, you can easily regain access to your computer without any damage being done. One of the best things about this software is that it allows you to create a password reset disk which can be used to reset the password of any target user account. The process is simple and straightforward and takes less than 10 minutes from start to finish. The first step in using UUkeys Windows Password Mate is downloading and installing the software on another accessible computer. Once installed, launch the program and insert a USB flash drive or CD/DVD into the computer. Then select "Burn USB" or "Burn CD/DVD" depending on which type of media you are using. After creating the password reset disk, insert it into your locked computer and boot from it by changing BIOS settings (if necessary). Once booted from the disk, select your target user account and click "Reset Password". Within seconds, your password will be removed successfully without losing any data stored on all drives. One thing worth mentioning here is that UUkeys Windows Password Mate does not damage or modify any files on your hard drive during this process; instead it simply removes/resetting passwords so that users can regain access again with ease. Another great feature of this software is its compatibility with all versions of Windows operating systems including XP/Vista/7/8/10 both 32-bit & 64-bit editions as well as various types of computers such as desktops/laptops/servers etc., making it an ideal solution for IT professionals who need quick access recovery tools at hand when dealing with multiple clients' computers daily basis. In addition to its ease-of-use and compatibility features mentioned above, UUkeys Windows Password Mate also offers advanced security measures such as AES-256 encryption algorithm which ensures maximum protection against unauthorized access attempts by hackers or malicious programs trying break-in through brute-force attacks etc., thus keeping all sensitive information safe at all times even if someone tries accessing them without permission! Overall, UUkeys Windows Password Mate stands out among other similar products in terms of its simplicity yet effectiveness when dealing with lost/forgotten passwords issues faced by many users worldwide today!
2016-11-23Command Prompt
1.0Command Prompt: A Fun and Prank-Friendly Web Application Are you looking for a fun way to prank your friends and family? Do you want to impress them with your "hacking" skills? Look no further than Command Prompt, a web application hosted at http://hackertyper.net that we've put inside of a native application frame. With Command Prompt, you can easily fool your friends into thinking that you're a legit hacker. Simply press Alt a few times to get an access granted alert or Caps Lock a few times to get an access denied alert. You can also hold down a key or pretend to type really fast and watch the magic happen. But Command Prompt isn't just for pranks. It's also useful for those who work in the tech industry or are interested in learning more about coding and programming. With its simple interface, users can practice typing commands and familiarize themselves with the command line interface. As part of the Utilities & Operating Systems category, Command Prompt is designed to be easy-to-use yet powerful enough for advanced users. Whether you're using it for fun or educational purposes, this web application is sure to provide hours of entertainment. So why wait? Download Command Prompt today and start impressing your friends with your "hacking" skills!
2015-04-08Enecsys PC Monitor
2.5Enecsys PC Monitor: The Ultimate Solution for Monitoring Your Solar System Are you one of the many people who have invested in a solar system with Enecsys Generation 1 inverters? If so, you may be aware that the original online monitoring software has ceased functioning. This can be frustrating, as it means that you are no longer able to monitor the status and performance of your system. But don't worry - there is a solution! Introducing Enecsys PC Monitor, a powerful software tool designed specifically for those with Enecsys Generation 1 inverters in their solar systems. With this software, you can continue to monitor your system's performance and ensure that everything is running smoothly. Enecsys PC Monitor is a PC-based program that runs under Windows 7+. It requires only a quick setup to tweak the local Gateway setting to communicate with your computer. Once set up, it provides continuous monitoring of your solar system's performance. One important thing to note is that it is recommended to set the PC running the program to use a static IP address. If this isn't done and DHCP assigns a new IP address to your computer, then the Gateway will need to be set again every time your IP address changes. But what exactly does Enecsys PC Monitor do? Here are some of its key features: Real-time monitoring: With Enecsys PC Monitor, you can keep an eye on how much energy your solar panels are producing at any given moment. This allows you to quickly identify any issues or problems with your system and take action if necessary. Data logging: In addition to real-time monitoring, Enecsys PC Monitor also allows you to export data logs of your system's production over time. This data can be exported directly into Excel for easy analysis and tracking. Customizable alerts: You can set up custom alerts within Enecsys PC Monitor so that you receive notifications when certain conditions are met (e.g., if energy production drops below a certain level). This helps ensure that any issues are addressed promptly before they become bigger problems. Easy-to-use interface: The user interface for Enecsys PC Monitor is intuitive and easy-to-use. Even if you're not particularly tech-savvy, you should have no trouble navigating through the various screens and settings within the program. Compatibility: As mentioned earlier, Enesysc PCSolarMonitor works under Windows 7+ operating systems which makes it compatible with most modern computers available today. In conclusion: If you're looking for an effective way to monitor the performance of your solar system with an enesys generation 1 inverter then look no further than enesys pc monitor! With its real-time monitoring capabilities,data logging features,and customizable alerts,you'll always know exactly how well your solar panels are performing.And thanks its user-friendly interface,it's easy enough even for those who aren't particularly tech-savvy.So why wait? Download enesys pc monitor today,and start getting more out ofyour solar investment!
2015-05-07Free DMG Extractor
1.0Free DMG Extractor - Your Ultimate Solution for Extracting DMG Files on Windows Are you a Windows user who has received a DMG file from a Mac user? Are you struggling to access the content of the file because it is compressed and encrypted? If yes, then Free DMG Extractor is the perfect solution for you. This software enables users to extract any type of DMG files on their Windows devices in just a few simple steps. DMG files are created by Apple Computers and are used with Mac OS. However, they are also supported by Windows OS. These files contain compressed content that is saved in a single file on your PC. The main purpose of this format is to share content over the internet as they do not require much disk space and can be managed easily. The Free DMG Extractor is an incredibly handy tool that extracts any type of DMG files without any glitches. It has a straightforward interface with a clean layout, making it easy for anyone to use without requiring technical expertise. One of the biggest advantages of using this software is that it's completely free from viruses and can be downloaded within minutes onto any device running on Windows OS. Once initiated, users can add their desired files onto the software and access them without any interruptions. Apart from viewing, users can extract and save content in their preferred destination folder with ease. Being lightweight, this tool requires moderate system resources while extracting multiple files at once (up to 5). This feature saves time and effort on behalf of users who need to extract multiple files simultaneously. In case you get stuck at any point while using this software, there's always help available through its 'help' file feature which provides step-by-step guidance throughout your extraction process. The Free DMG Extractor is dedicated software designed specifically for extracting files into ISO or BIN formats quickly and efficiently. With its user-friendly interface coupled with its ability to handle various types of compressed data formats such as ZIP or RAR archives makes it an essential tool for anyone looking to manage their data more effectively. In conclusion, if you're looking for an efficient way to extract your desired content from compressed or encrypted DMG files on your Windows device quickly - look no further than Free DMG Extractor!
2016-07-04Google Chrome Speed Booster
1.0Are you tired of slow web browsing speeds? Do you want to increase your productivity and efficiency while using Google Chrome? Look no further than the Google Chrome Speed Booster, a powerful utility software designed to optimize your web browsing experience. As a utility software, the Google Chrome Speed Booster falls under the category of Utilities & Operating Systems. This program is specifically designed for users who frequently use Google Chrome as their primary web browser. With this software, you can increase your web browsing speed up to 5 times faster than before! The program runs in the background and displays a small icon on the bottom of your screen automatically making your web browsing experience faster. This means that you don't have to do anything extra or change any settings - simply install the program and let it work its magic. One of the best things about this software is that it's completely free! There are no ads, banners, or adware included with this program. Additionally, there are no upsells or hidden fees - everything is always 100% free. So how does it work? The Google Chrome Speed Booster optimizes various settings within Google Chrome to make it run more efficiently. This includes clearing cache and cookies, disabling unnecessary extensions and plugins, and optimizing network settings for faster page loading times. To get started with this powerful utility software, simply download your free copy from our website. Once installed on your computer, you'll notice an immediate improvement in your web browsing speed. No longer will you have to wait for pages to load or deal with frustrating lag times - with the Google Chrome Speed Booster on your side, everything will be lightning fast! In addition to its impressive speed-boosting capabilities, this software also offers several other benefits for users: - Improved security: By clearing cache and cookies regularly, you'll reduce the risk of malware infections and other security threats. - Increased privacy: Clearing cache also helps protect your online privacy by removing any traces of websites visited. - Better performance: By disabling unnecessary extensions and plugins that may be slowing down your browser performance overall system performance can improve. - User-friendly interface: The simple interface makes it easy for anyone to use without needing technical knowledge Overall if you're looking for a way to improve productivity while using google chrome then look no further than "Chrome Speed Booster". It's fast easy-to-use reliable secure private user-friendly interface makes it one of our top picks when looking at utilities & operating systems available today!
2015-06-25Mini Mouse Macro
4.0Mini Mouse Macro: The Ultimate Mouse and Keyboard Recording Macro Are you tired of performing repetitive tasks on your computer? Do you wish there was an easier way to automate your mouse and keyboard actions? Look no further than Mini Mouse Macro, the free mouse and keyboard recording macro that takes automation to the next level. Unlike other mouse macros out there, Mini Mouse Macro actively records your mouse movements, clicks, and keys in real time. No more entering x and y positions or guessing what actions to take. With Mini Mouse Macro, simply perform the actions you want recorded and let the software do the rest. But that's not all - Mini Mouse Macro also allows you to save your macros for future use. Need to perform a specific task again? Simply load up the saved macro and let it do its magic. This feature saves time and effort by eliminating the need to manually repeat tasks. Mini Mouse Macro is perfect for anyone who wants to streamline their workflow or reduce repetitive strain injuries caused by excessive clicking or typing. Whether you're a gamer looking for an edge in competitive play or a professional seeking greater efficiency in your workday, Mini Mouse Macro has something for everyone. So why choose Mini Mouse Macro over other macro software options? Here are just a few reasons: - Real-time recording: Unlike other macros that require manual input of coordinates or actions, Mini Mouse Macro records everything as it happens. - Easy-to-use interface: The intuitive interface makes creating macros simple even for beginners. - Customizable settings: Adjust playback speed, delay times between actions, repeat loops, hotkeys - whatever suits your needs. - Save/load functionality: Save frequently used macros for easy access later on. - Free download: No need to spend money on expensive automation software when you can get all these features for free with Mini Mouse Macro. In addition to its core features listed above, here are some additional ways users have found value in using Mini Mouse Marco: Gaming: Gamers can use this tool as an advantage while playing games like Minecraft where they have multiple clicks required at once which can be done easily with this tool without any hassle of doing it manually every time they play. Productivity: Professionals who work with spreadsheets often find themselves repeating similar tasks over long periods of time which can be automated using this tool saving them hours of manual labor every week/month/year depending upon how frequently they use it. Accessibility: People with disabilities such as carpal tunnel syndrome find relief from pain caused by excessive clicking/tapping/typing through automating their most frequent activities using this tool. Overall if you're looking for an easy-to-use yet powerful macro recorder that will save you time while increasing productivity then look no further than Mini-Mouse-Macro!
2015-09-03Pangu
1.0.0Pangu 9: The Ultimate Jailbreak Solution for iOS 9 Are you tired of the limitations imposed by Apple on your iOS device? Do you want to customize your iPhone or iPad according to your preferences? If yes, then Pangu 9 is the perfect solution for you. Pangu 9 is a freeware that allows users to jailbreak their iOS devices running on iOS 9 through 9.0.2 untethered. What is Jailbreaking? Jailbreaking refers to the process of removing software restrictions imposed by Apple on its iOS devices. By jailbreaking an iPhone or iPad, users can install third-party apps and tweaks that are not available in the App Store. It also allows them to customize their device's interface, change system settings, and access files that are otherwise inaccessible. Pangu 9 Supported Devices Pangu 9 supports a wide range of iOS devices running on iOS 9 through 9.0.2 untethered. These include: - iPhone: iPhone 6s, iPhone 6s Plus, iPhone 6, iPhone 6 Plus, iPhone SE (1st generation), iPhone SE (2nd generation),iPhone5s,iPhone5c,iPhone5,iPhone4s - iPad: iPad Air2,iPad Air,iPad4th gen.,iPad3rd gen.,iPad2nd gen.,Retina iPadmini1stgen.,iPadmini3rdgen.,iPadmini4thgen. - iPod touch: iPod touch(5th generation), iPod touch(6th generation) Step-by-Step Guide for Using Pangu Using Pangu is easy and straightforward with our step-by-step guide: Step One: Connect Your Device to PC via USB Cable Connect your device to your PC using a USB cable. Step Two: Run Pangu Run the Pangu application on your computer. Step Three: Wait Until Your Device Is Identified Wait until Pangu identifies your device automatically. Step Four: Click Black Jailbreak Button Click on the black "Jailbreak" button in the center of the screen. Step Five: Wait for Process Completion Wait while Pangu performs its magic and completes the jailbreak process automatically within few minutes. Step Six: Cydia Icon Appears Once completed successfully, you will see Cydia icon appear at end of pango jailbreak. Why Choose Pangu? There are several reasons why you should choose Pangu over other jailbreaking tools available in market: 1) Easy-to-use Interface - The user-friendly interface makes it easy even for beginners who have never used any kind of software before. 2) Wide Range Of Supported Devices - Unlike other tools which only support limited number of devices, pango supports wide range from iPhones, iPads & iPod Touches. 3) Fast And Reliable - With its advanced technology, pango ensures fast and reliable performance without any glitches or errors during installation process. 4) Free Of Cost - Unlike other paid tools which charge hefty amount from users, pango offers free-of-cost service without compromising quality standards. Conclusion: In conclusion,Pangus' latest version i.e.Pangus' version v1.3 has been released with improved stability & bug fixes. It's one-stop solution for all those who want more control over their iPhones/iPads/iPod Touches. With its user-friendly interface & advanced technology,it ensures fast & reliable performance without any glitches or errors during installation process.So if you're looking forward towards customizing your iDevice according to preferences then go ahead download Pangus' latest version today!
2015-10-15WRITEit
2.0Lenovo's WRITEit 2 is a powerful software that transforms your touch-screen device into a canvas, allowing you to add notes, draw, write and annotate over anything on your screen. Whether you're using your pen or finger, WRITEit 2 makes it easy to write on, draw, highlight, doodle or mark up anything on your screen. With this software installed on your Lenovo Touchscreen device running Windows 8.x or 10 operating system, you can easily add notes and annotations to documents, photos, presentations and webpages. WRITEit 2 is designed with simplicity in mind. The user interface is intuitive and easy to navigate. You can access the app menu by tapping the WRITEit icon located in the taskbar of your device. The app menu includes twelve pen colors in three widths and four highlighter colors along with an eraser tool for quick corrections. One of the most impressive features of WRITEit 2 is its ability to recognize handwriting accurately. This feature allows you to write naturally using either a stylus or finger without worrying about making mistakes due to poor recognition technology. Another great feature of this software is its ability to save work as an image file which can be shared with others via email or social media platforms such as Facebook and Twitter. You can also save it directly onto your device for future reference. WRITEit 2 also comes with a blank canvas option that allows users to create their own drawings from scratch without any limitations whatsoever! This feature makes it perfect for artists who want complete creative freedom when working on their digital art projects. In addition to being an excellent tool for artists and designers alike, WRITEit 2 has many practical applications as well. For example: - Students can use it during lectures or while studying at home. - Business professionals can use it during meetings or presentations. - Writers can use it while taking notes during interviews. - Anyone who needs quick access to note-taking capabilities will find this software incredibly useful! Overall, Lenovo's WRITEit 2 is an excellent utility software that offers users unparalleled flexibility when working with touch-screen devices running Windows operating systems. Its ease-of-use combined with its powerful features make it one of the best utilities available today!
2016-02-25ClrMamePro
4.021aClrMamePro: The Ultimate ROM Management Tool If you're an avid gamer or emulator enthusiast, you know how important it is to have a reliable and efficient tool for managing your ROM files. That's where ClrMamePro comes in - a powerful utility that has been trusted by the emulation community for years. What is ClrMamePro? ClrMamePro is a ROM management tool that helps you organize and verify your game files. It checks each individual file against a data file to ensure that they contain the correct information, making sure that your games run smoothly without any glitches or errors. Why do I need ClrMamePro? If you're into emulation, chances are you have hundreds or even thousands of ROM files on your computer. Manually verifying each one can be time-consuming and tedious, not to mention prone to human error. With ClrMamePro, all of this can be done automatically with just a few clicks. Not only does it save time and effort, but it also ensures that your games are running at their best possible quality. By verifying each file against its corresponding data file, ClrMamePro can detect any discrepancies or missing information in the ROMs and fix them accordingly. Features of ClrMamePro - Automatic scanning: Simply point ClrMamePro to the folder containing your ROMs and let it do its magic. It will scan through all of the files and compare them against their respective data files. - Customizable settings: You can configure various options such as which data files to use, what types of errors to ignore or fix automatically, etc. - Batch operations: If you need to perform certain actions on multiple files at once (e.g., renaming them), ClrMamePro makes it easy with its batch processing feature. - User-friendly interface: Despite being packed with advanced features, ClrMamePro has an intuitive interface that's easy to navigate even for beginners. - Support for multiple platforms: While originally designed for arcade emulators like MAME (hence the name), ClrMamePro now supports various console emulators as well. How does it work? When you launch Clrmampro for the first time after installation, you will see an empty database window. You will then need add some datfiles which contains information about romsets. These datfiles are available from various sources online. Once added, you then scan folders containing romsets using these datfiles. The software compares every single romset in these folders against what’s listed in these datfiles. It checks if there are any missing sets, extra sets, incorrectly named sets etc.Once this process completes successfully,you get green ticks next every set indicating they match exactly what’s listed in those datfiles. Any incorrect sets found during this process can be fixed manually by renaming them yourself or letting clrmampro do so automatically based on rules defined by user. Conclusion In conclusion,Crlmampro is an essential tool if you’re into emulation scene.It saves lot of time when dealing with large number of romsets.It ensures all romsets match exactly what’s listed in those datfiles thereby ensuring smooth gameplay experience without any issues.Clrmaempro has been around since 2002,and continues receive updates till date making sure its compatible latest operating systems out there.So go ahead give Crlmampro try today!
2015-07-22Satellite Antenna Alignment
2.99Satellite Antenna Alignment is a powerful software tool designed to help you calculate the angles necessary for installing satellite dishes. This utility falls under the category of Utilities & Operating Systems and is an essential tool for anyone who wants to install a satellite dish. With Satellite Antenna Alignment, you can easily calculate the position for all satellites at once. This feature gives you a clear picture of what satellites can be physically visible from the location where the dish will be installed. It should be noted that this program makes a purely theoretical calculation according to formulas, and in real circumstances, many additional factors should be taken into account when installing a satellite dish. However, this program will allow you to evaluate the position quite precisely. The calculation can be saved to a text file, copied to the Windows clipboard or printed out at once. It is also possible to save the list of locations for which the calculation is done so that later on, you will not have to enter their coordinates again; just select them from the table. Satellite Antenna Alignment has an intuitive user interface that makes it easy for anyone with basic computer skills to use it effectively. The software comes with detailed instructions on how to use it and provides step-by-step guidance throughout each process. One of its most significant advantages is its ability to work with multiple satellites simultaneously. This feature saves time and effort by allowing users to calculate all necessary angles in one go instead of having them do it manually one by one. The software also allows users to customize their calculations based on specific parameters such as latitude, longitude, elevation angle, azimuth angle and more. These features make Satellite Antenna Alignment highly versatile and adaptable for different types of installations. Another great feature offered by Satellite Antenna Alignment is its ability to provide accurate results even in areas where there are obstructions such as trees or buildings blocking line-of-sight access between your location and your desired satellite(s). By taking these obstructions into account during calculations, this software ensures that your installation will work correctly without any interference issues caused by obstacles in your area. In conclusion, if you're looking for an efficient way of calculating angles necessary for installing satellite dishes accurately while saving time and effort simultaneously – look no further than Satellite Antenna Alignment! With its intuitive user interface coupled with advanced features like multi-satellite support and obstruction detection capabilities – this utility has everything needed by both novice users as well as experienced professionals alike!
2015-04-07R for Windows
3.2.1R for Windows is a powerful and versatile software suite that provides users with a comprehensive set of tools for data manipulation, calculation, and graphical display. This software is designed to help users analyze complex data sets quickly and efficiently, making it an essential tool for researchers, analysts, and statisticians. With R for Windows, users can easily handle large amounts of data thanks to its effective data handling and storage facility. The software also includes a suite of operators specifically designed for calculations on arrays such as matrices. This makes it easy to perform complex calculations on large datasets without the need for additional programming or scripting. One of the standout features of R for Windows is its extensive collection of intermediate tools for data analysis. These tools are integrated into the software in a coherent manner that makes it easy to access them when needed. Whether you need to perform statistical analysis or create visualizations from your data, R has you covered. In addition to its analytical capabilities, R also offers powerful graphical facilities that allow users to visualize their data in various ways. Whether you prefer on-screen displays or hardcopy printouts, this software has everything you need to create professional-quality graphs and charts. Another key feature of R is its simple yet effective programming language. With support for conditionals, loops, user-defined recursive functions and input/output facilities built-in; this language allows users with little-to-no programming experience can quickly learn how to use it effectively. Overall,RforWindowsis an excellent choice if you're lookingforpowerfuldataanalysisandvisualizationtools.Theintegratedsuiteofsoftwarefacilitiesmakesitaneasy-to-useandversatiletoolthatcanhandleevenlargeandcomplexdatasetswith ease.Withitswell-developedprogramminglanguageandextensivecollectionofintermediatetools,RforWindowsisapowerfuladditiontoanyresearcher'soranalyst'stoolbox.Soifyou'relookingtobetterunderstandyourdataandsimplifyyouranalysisprocesses,giveRforWindowsa trytoday!
2015-07-22MouseMote Server
1.8MouseMote Server is a powerful server software that enables you to use your phone as an in-air mouse, touchpad mouse, keyboard and more. This innovative app allows you to control your computer from the comfort of your couch or anywhere else in the room. With MouseMote Server, you can easily surf the web, watch movies or even give presentations without having to be physically close to your computer. The most important feature of MouseMote Server is its airmouse function. This feature allows you to control your computer mouse by simply moving your phone around in the air. The app uses the built-in motion sensors on your Android phone to detect the angle at which you hold it and translates this movement into mouse movements on your computer screen. This means that with MouseMote Server, you can easily navigate through menus and web pages without having to use a physical mouse or touchpad. You can also use it as a remote control for media players like VLC or Windows Media Player. In addition to its airmouse function, MouseMote Server also comes with other useful features such as touchpad mode which lets you use your phone's screen as a touchpad for precise cursor movements. You can also switch between different modes like keyboard mode which lets you type on your computer using just your phone's virtual keyboard. Another great feature of MouseMote Server is its ability to customize gestures and actions according to user preferences. For example, users can set up custom gestures for opening specific applications or performing certain tasks like scrolling up/down through documents. MouseMote Server is easy-to-use and requires no additional hardware other than an Android smartphone running version 4.0 or higher with Bluetooth connectivity enabled. The app works seamlessly with Windows operating systems including Windows 7/8/10 (32-bit & 64-bit) making it ideal for both personal and professional use. Overall, if you're looking for an innovative way of controlling your PC from afar then look no further than MouseMote Server! Its intuitive interface coupled with advanced features make it one of the best utilities available today!
2016-03-28PowerGrep
4.6.5PowerGrep is a powerful software tool that allows you to search for information in files and folders on your computer. Whether you're looking for text, keywords, or phrases in text files, Word documents, or PDF files, PowerGrep can help you find what you need quickly and easily. One of the key features of PowerGrep is its ability to search for byte sequences in binary files. This means that even if the information you're looking for isn't stored as plain text, PowerGrep can still help you find it. You can also get a list of files or a list of search matches and their contexts, making it easy to navigate through large sets of data. In addition to searching for specific pieces of information, PowerGrep also allows you to extract raw data from files. This can be useful if you need to work with data in a different format than it's currently stored in. You can also get useful statistics by grouping, counting, and sorting search matches. One of the most powerful features of PowerGrep is its rich regular expression support. Regular expressions allow you to specify the form of what you want and let PowerGrep find the actual text that matches that form. This makes it easy to search for complex patterns or variations on a theme. PowerGrep also includes comprehensive search-and-replace functionality with or without regular expressions. This means that not only can you find specific pieces of information quickly and easily but also make changes across multiple documents at once without having to manually edit each one individually. Another important feature is its extensive backup and undo options which ensure safe working practices when making changes across multiple documents at once. Finally, if needed duplicate files during search-and-replace operations are possible allowing users create different editions from their original set while maintaining an original copy as well. Overall this software tool provides an efficient way for users who work with large sets of data regularly such as developers who need quick access into codebases they are working on daily basis; researchers who have vast amounts research papers they need access too; writers who have many drafts they want compare against each other etc..
2015-07-21Garmin WebUpdater
2.5.6Garmin WebUpdater: The Ultimate Solution for Upgrading Your Garmin GPS Software Are you tired of manually updating your Garmin GPS software? Do you want a hassle-free solution that automatically detects and installs the latest version of operating software for your compatible Garmin GPS? Look no further than Garmin WebUpdater - the free, easy-to-use application that simplifies the process of upgrading your device's software. As a leading provider of navigation technology, Garmin understands the importance of keeping your GPS up-to-date with the latest features and improvements. With WebUpdater, you can ensure that your device is always running at its best by effortlessly installing new updates as they become available. So what exactly is WebUpdater, and how does it work? Let's take a closer look at this powerful utility. What is Garmin WebUpdater? WebUpdater is a free application from Garmin that allows you to update the operating software on your compatible GPS device. Whether you're using a handheld unit or an in-car navigation system, WebUpdater makes it easy to keep your device up-to-date with the latest features and improvements. With its simple interface and intuitive design, even novice users can quickly learn how to use WebUpdater to upgrade their devices. And because it's completely free to download and use, there's no reason not to take advantage of this powerful tool. How Does It Work? Using WebUpdater couldn't be easier. Simply connect your compatible Garmin GPS device to your computer using a USB cable (which may be sold separately), then run the application on your computer. The program will automatically detect which model of GPS unit you have connected and check for any available updates. If an update is available for your device, simply follow the on-screen prompts to download and install it onto your unit. You'll be prompted throughout each step so there are no surprises along the way! One great feature about this program is that it checks if there are any updates needed before performing an update on itself first! This means that when updating multiple units over time or after purchasing new ones - all future upgrades will be done through one installation process without having to re-download anything else yourself! What Are Some Key Features? Web Updater has several key features designed specifically with user convenience in mind: - Automatic detection: When connected via USB cable (sold separately), web updater will automatically detect which model of compatible garmin gps unit has been connected. - Simple interface: The user-friendly interface makes upgrading operating software quick & easy. - Free downloads: All downloads are completely free! - No need for manual downloads: Once installed onto computer system - future upgrades can be done through one installation process without having re-download anything else yourself! - Compatibility across devices: Compatible with most garmin gps units including handhelds & in-car navigation systems. - Regularly updated database: Database regularly updated ensuring users have access most recent versions available. Why Should You Use It? There are many reasons why upgrading operating software should not only be considered but also prioritized! Here are just some benefits: 1) Improved performance – Newer versions often come equipped with bug fixes & performance enhancements making them more efficient overall 2) Enhanced functionality – Newer versions often come equipped with additional features such as voice commands or improved mapping capabilities 3) Increased safety – Updated maps help ensure drivers stay safe while navigating unfamiliar roads 4) Better battery life – Updated firmware helps improve battery life by optimizing power usage By utilizing web updater regularly users can ensure their garmin gps units remain up-to-date providing optimal performance & functionality while also increasing safety measures during travel. Conclusion In conclusion, if you own a compatible garmin gps unit then web updater should definitely become part of regular maintenance routine! With its automatic detection feature & simple interface anyone can easily upgrade their operating system without needing technical expertise or spending money on professional services. Plus all downloads being completely free means there’s nothing stopping anyone from taking advantage today!
2015-07-22Galaxy Unlocker Client
14.12.69Galaxy Unlocker Client - The Ultimate Samsung Device Unlocking Software Are you tired of being locked into a specific network carrier with your Samsung phone or tablet? Do you want the freedom to use your device on any network that uses SIM cards? Look no further than Galaxy Unlocker Client, the ultimate unlocking software for Samsung devices. Designed specifically for Samsung phones and tablets, GalaxyUnlocker is a powerful utility that allows you to unlock your device quickly and easily. With just a USB cable and this software, you can unlock your device in minutes and enjoy the freedom of using it on any network carrier. How Does It Work? GalaxyUnlocker works by reading the original unlock code from your Samsung phone or tablet. This code is unique to each device and is stored in its firmware. Once GalaxyUnlocker has read this code, it can automatically unlock your device or make the code available to you so that you can manually enter it yourself. To use GalaxyUnlocker, simply connect your Samsung device to your computer with a USB cable. Then launch the software and follow the easy-to-use instructions provided. Within minutes, your device will be unlocked and ready for use on any compatible network carrier. Why Choose Galaxy Unlocker Client? There are many reasons why GalaxyUnlocker is the best choice for unlocking your Samsung phone or tablet: 1. Easy-to-Use Interface: The user-friendly interface makes unlocking simple even for those who are not tech-savvy. 2. Fast & Reliable: With its advanced algorithms, GalaxyUnlocker unlocks devices quickly and reliably without causing any damage to them. 3. Wide Compatibility: This software supports all models of Samsung phones and tablets running Android OS versions 2.x through 7.x. 4. Safe & Secure: Your personal data remains safe during unlocking as there is no need to root or modify anything on your device's firmware. 5. Affordable Pricing: Compared to other similar services available in the market today, our pricing structure offers great value-for-money without compromising quality service delivery standards. What Can You Do After Unlocking Your Device? Once unlocked with our software solution - You will have access to all features of an unlocked smartphone including: 1) Use Any Network Carrier - Enjoy complete freedom when choosing which mobile service provider suits best based on their coverage area(s), pricing plans etc., 2) Travel Freely - No more roaming charges when traveling abroad as now you can purchase local SIM cards at affordable rates, 3) Increase Resale Value - An unlocked smartphone has higher resale value compared with one locked into one specific mobile service provider, 4) Install Custom ROMs – Unlocked smartphones allow users greater flexibility when installing custom ROMs which offer additional features not found in stock firmware. Conclusion In conclusion, if you're looking for an easy-to-use yet powerful tool that unlocks all models of Samsung phones/tablets running Android OS versions 2.x through 7.x then look no further than Galaxy Unlocker Client! Our reliable solution ensures fast results while keeping personal data safe throughout every step along way; plus we offer affordable pricing options too! So why wait? Download now & start enjoying complete freedom over how/where/when use smartphone today!
2015-01-20Pure APK Install
1.4.583Pure APK Install: The Ultimate Solution for Installing XAPK and APK Games and Apps to Android Devices from Your PC Are you tired of not being able to install your favorite apps on your Android device due to region restrictions or unsupported Google Play Store? Do you want a hassle-free way of installing XAPK and APK games and apps directly from your PC? Look no further than Pure APK Install! Pure APK Install is a powerful utility software that allows you to install XAPK and APK games and apps directly from your PC onto any Android device. Whether it's Samsung, HTC, Motorola, Huawei, LG, Lenovo, Mi or Micromax - Pure APK Install supports all major Android brands. With Pure APK Install, you can break the region restrictions imposed by Google Play Store. This means that even if an app is not available in your region or if Google Play Store is not supported on your device manufacturer's version of Android OS - you can still install the app using Pure APK Install. The best part about this software is that it's completely free! You don't have to pay anything to use this amazing tool. Plus, it works perfectly with Windows 8.1, Windows 8, Windows 7 (32/64bit), and even Windows XP. Pure APK Install supports all versions of Android OS starting from 2.3 up until the latest version - Android 5.1.1 Lollipop has already been tested with this software. One-click installation makes it incredibly easy for anyone to use this software without any technical knowledge required whatsoever! Simply download the XAPK or APK package onto your PC and click on "Install" in Pure Apk Installer - that's it! Another great feature of Pure Apk Installer is its ability to install any free Google Play Store application or verified source apk file with ease. However please note that installing third-party apk files comes with its own risks as these files are not trusted by either Google Play or Amazon store nor are they verified by our website (apkpure.com). Therefore we recommend caution when downloading such files as they may contain malware which could harm both yourself as well as other users who share their devices with you. Top Features: 1) One-click installation: With just one click on "Install", users can easily install their desired XAPK/APK packages onto their android devices without any hassle. 2) Supports all major android brands: Whether it’s Samsung Galaxy S21 Ultra, HTC U12+, Motorola Moto G Power (2020), Huawei P40 Pro+, LG V60 ThinQ 5G UW, Lenovo Legion Phone Duel, Xiaomi Mi Note 10 Lite, Micromax In Note 1 – pure apk installer supports them all! 3) Compatible across multiple windows operating systems: Works perfectly fine across various windows operating systems including Windows XP/7/8/8.1 4) Supports multiple versions of android OS: From older versions like Gingerbread(2.3.x) up until latest version like Lollipop(5.x) 5) Breaks google play store region restrictions: Allows users access applications which may be restricted in certain regions. 6) Installs free google play store applications & apkpure verified source apk files: Users can now easily download & install free google play store applications alongwith apkpure verified source apk files. In conclusion, If you're looking for a reliable way of installing XAPK/APK packages onto your android devices without having to worry about regional restrictions then look no further than pure apk installer! It’s easy-to-use interface coupled with its compatibility across various windows operating systems makes it an ideal choice for anyone looking for a hassle-free solution when installing third-party applications onto their android devices. However please note that while using third party sources comes at its own risk so we recommend caution when downloading such files as they may contain malware which could harm both yourself as well as other users who share their devices with you..
2015-08-24